Recombinant Human Dual Specificity Mitogen-Activated Protein Kinase Kinase 6 (MAP2K6) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09389P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Dual Specificity Mitogen-Activated Protein Kinase Kinase 6 (MAP2K6) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09389P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Dual Specificity Mitogen-Activated Protein Kinase Kinase 6 (MAP2K6) Protein (His) is produced by our Baculovirus expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P52564
Target Symbol MAP2K6
Synonyms Dual specificity mitogen activated protein kinase kinase 6; Dual specificity mitogen-activated protein kinase kinase 6; MAP kinase kinase 6; MAP2K6; MAPK/ERK kinase 6; MAPKK 6; MAPKK6; MEK 6; MEK6; Mitogen Activated Protein Kinase Kinase 6 ; MKK 6; MKK6; MP2K6_HUMAN; PRKMK6; protein kinase; Protein kinase mitogen activated kinase 6; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPK kinase 3; SAPKK-3; SAPKK3; SKK3; Stress-activated protein kinase kinase 3
Species Homo sapiens (Human)
Expression System Baculovirus
Tag N-6His
Target Protein Sequence MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Expression Range 1-334aa
Protein Length Full Length
Mol. Weight 39.5kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.
Subcellular Location Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Note=Binds to microtubules.
Protein Families Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
Database References

HGNC: 6846

OMIM: 601254

KEGG: hsa:5608

STRING: 9606.ENSP00000468348

UniGene: PMID: 27526785

  • acts as a repressor of UCP1 expression, suggesting that its inhibition promotes adipose tissue browning and increases organismal energy expenditure PMID: 29021624
  • Data indicate that mitogen-activated protein kinase kinase 6 (MKK6) levels were substantially higher in monocytes than in neutrophils. PMID: 25214442
  • Data show significant increase in the expression of MKK6 in Esophageal, Stomach, and Colon cancers as compared to controls. PMID: 25019214
  • uncover a new mechanism of deactivation of MKK6-p38 and substantiate a novel regulatory role of FBXO31 in stress response PMID: 24936062
  • Serine phosphorylation of p66shc is carried out by active MKK6. beta-Amyloid-induced ROS production and apoptosis increased in the presence of MKK6 and p66shc, which directly associate. PMID: 24085465
  • The models confirmed the reaction order, revealed processivity in the phosphorylation of MEK6 by ASK1, and suggested that the order of phosphorylation is dictated by both binding and catalysis rates. PMID: 23744074
  • crystal structure of human non-phosphorylated MAP2K6 (npMAP2K6) complexed with an ATP analogue was determined at 2.6 A resolution and represents an auto-inhibition state of MAP2K6 PMID: 22383536
  • activation by mechanical stretch induces HMGB1 and cytokine expression in A549 cells PMID: 21926646
  • Results suggest that the p38alpha, MAPK, and MKK6 play prominent roles in IL-1beta and C/EBP-beta-mediated C3 gene expression in astrocytes. PMID: 21308746
  • Impaired cytokine production in natural killer (NK)T cells is demonstrated from MKK3-deficient6+/- mice. PMID: 21368234
  • we demonstrated that MKK6 has a role for regulation of dendricity in melanocytes. PMID: 20869211
  • MKK6 and other MAP2Ks are a distinct class of cellular redox sensors PMID: 21078955
  • MKK6 p38 alpha signaling pathway regulates the expression of RAGE induced by mechanical stretch in A549 cells. PMID: 19846005
  • Mechanism of oxidative stress-induced ASK1-catalyzed MKK6 phosphorylation.( PMID: 20364819
  • active MKK6 in HepG2 cells enhanced basal activity or IL-6-induced transcriptional activation of a SOCS3 promoter PMID: 11727828
  • MKK6 is involved in a positive feedback loop regulating macrophage signaling with p38 MAP kinase PMID: 12509443
  • role in cardioprotection PMID: 15492008
  • PAK6 kinase activity was repressed by a p38 mitogen-activated protein (MAP) kinase antagonist and could be strongly stimulated by constitutively active MAP kinase kinase 6 (MKK6) PMID: 15550393
  • MKK6 promotes the development of cardiomyopathy by activation of a kinase cascade PMID: 15722372
  • MEK6E activates p38 and results in phosphorylation of its downstream substrate, heat shock protein 27 PMID: 15790570
  • selectivity pocket compounds prevent MKK6-dependent activation of p38alpha in addition to inhibiting catalysis by activated p38alpha PMID: 16342939
  • findings show that Yersinia YopJ acted as an acetyltransferase, using acetyl-coenzyme A (CoA) to modify the critical serine and threonine residues in the activation loop of MAPKK6 and thereby blocking phosphorylation PMID: 16728640
  • Conditional induction of a dominant active form of MAPK kinase 6, a direct upstream kinase of p38, in Langerhans cells induces up-regulation of costimulatory molecules & enhances their T-cell stimulatory capacity. PMID: 16960152
  • Data suggest that sequence variations of ASK1 and MAP2K6 lead to partially sex-specific changes in the levels and/or phosphorylation states of p38 and p38-regulated proteins that might contribute to the observed delaying effects in the age of onset of HD. PMID: 18327563
  • Gel filtration and small-angle X-ray scattering analysis confirm that the crystallographically observed ellipsoidal dimer is a feature of MEK6/DeltaN/DD and full-length unphosphorylated wild-type MEK6 in solution PMID: 19141286
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed