Recombinant Human Dnaj Homolog Subfamily B Member 1 (DNAJB1) Protein (GST)

Name: Recombinant Human Dnaj Homolog Subfamily B Member 1 (DNAJB1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08454P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Dnaj Homolog Subfamily B Member 1 (DNAJB1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25685
Target Symbol	DNAJB1
Synonyms	DnaJ (Hsp40) homolog subfmaily B member 1; DNAJ 1; DNAJ B1; DnaJ heat shock protein family (Hsp40) member B1; DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; DNAJ1; DNAJB 1; Dnajb1; DNAJB1 protein; DNJB1_HUMAN; HDJ 1 ; HDJ-1; HDJ1; Heat shock 40 kDa protein 1; Heat shock 40kD protein 1; Heat shock protein 40; Hsp 40; HSP40; HSPF 1; HSPF1; Human DnaJ protein 1; Radial spoke 16 homolog B; RSPH16B; Sis1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Expression Range	1-340aa
Protein Length	Full Length
Mol. Weight	65.0kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
Subcellular Location	Cytoplasm. Nucleus. Nucleus, nucleolus. Note=Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
Database References	HGNC: 5270 OMIM: 604572 KEGG: hsa:3337 STRING: 9606.ENSP00000254322 UniGene: PMID: 29069650 Modeling of the different conformations of PRKACA-DNAJB1 Chimeric Kinase revealed no obvious steric interactions of the J-domain with the rest of the RIIbeta holoenzyme. PMID: 29335433 Data show that DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) is a transcriptional target of forkhead box protein E3 (FOXE3) in a pathway that is crucial for the development of the anterior segment of the eye. PMID: 27218149 These results indicate that Mixed fibrolamellar hepatocellular carcinoma (mFL-HCC) is similar to pure FL-HCC at the genomic level and the DNAJB1:PRKACA fusion can be used as a diagnostic tool for both pure and mFL-HCC PMID: 27029710 These studies demonstrate an important role for cellular chaperone Hsp40/DnaJB1 in influenza A virus life cycle by assisting nuclear trafficking of viral ribonucleoproteins. PMID: 26750153 DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target PMID: 26505878 study provides a new molecular mechanism to regulate EGFR signaling through modulation of MIG6 by DNAJB1 as a negative regulator. PMID: 26239118 Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3. PMID: 25122662 In this cohort of fibrolamellar hepatocellular carcinoma, almost 80% contained the DNAJB1-PRKACA fusion transcript. PMID: 25557953 Authors identified DNAJB1 as a negative regulator of PDCD5-mediated apoptosis and found that the apoptosis network of PDCD5 regulates cancer cell death. PMID: 25444898 We also found that, despite an initial report to the contrary, the human homolog of Sis1, Hdj1, is capable of [PSI+] prion propagation in place of Sis1 PMID: 25058638 HSP40 interacts with pyruvate kinase M2 and regulates glycolysis and cell proliferation in tumor cells. PMID: 24658033 Studies with specific phosphoantibodies indicate that MK5 phosphorylates Hsp40/DnaJB1 in vivo at Ser-149 or/and Ser-151 and Ser-171 in the C-terminal domain of Hsp40/DnaJB1. PMID: 24309468 Evidence supporting the presence of the DNAJB1-PRKACA chimeric transcript in 100% of the FL-HCCs examined (15/15) suggests that this genetic alteration contributes to tumor pathogenesis. PMID: 24578576 we discovered a new MDM2 interacting protein, DNAJB1, and provided evidence to support its p53-dependent tumor suppressor function. PMID: 24361594 HSP40 and HSP110 function together in protein homeostasis control. PMID: 24091676 methionine deprivation results in an antioxidant response that includes an increase in the levels of HSPA1A and DNAJB1 mRNA PMID: 23395854 There was a positive correlation between DnaJB1 and severity of pulmonary arterial hypertension in peripheral blood mononuclear cells from patients with limited cutaneous systemic sclerosis. PMID: 23400395 Hsp40 regulates the amount of keratin proteins via ubiquitin-proteasome pathway. PMID: 22075554 Mammalian Hsp110 (Apg-2), Hsp70 (Hsc70 or Hsp70) and Hsp40 (Hdj1) were necessary and sufficient to slowly dissolve large disordered aggregates and recover natively folded protein PMID: 22022600 Cellular localization studies showed that NP and Hsp40 co-localize primarily in the nucleus. During IAV infection in mammalian cells, expression of NP coincided with the dissociation of P58(IPK) from Hsp40 and decrease PKR phosphorylation PMID: 21698289 The antiviral activity of overexpressed DNAJC14 occurs in a time- and dose-dependent manner. PMID: 21249176 The crystal structure of full-length Hdj1 was diffracted to 3.90A resolution. PMID: 21139202 5-fluorouracil & carboplatin specifically induce expression of Hsp40 in hepatoma cells. siRNA knockdown of Hsp40 diminishes survival of drug-exposed cells. PMID: 19901540 Altered expression of HSPF1 was found in brains and lymphoblastoid cells from patients with bipolar disorder. PMID: 14743183 sequestered in discrete foci in the nucleus of the infected cell in herpes simplex virus type 1 infection PMID: 15194794 It is confirmed an increased expression of HSPF1 in the lymphoblastoid cell lines from patients with bipolar I disorder, bipolar II disorder, and schizophrenia. PMID: 15362566 Hsp40 is crucial for Nef-mediated enhancement of viral gene expression and replication PMID: 16179353 hepatitis B virus X protein is the major target of Hdj1 in the inhibition of hepatitis B virus replication PMID: 16842747 These results demonstrate a role for Hsp40/DnaJB6 in the regulation of HIV-2 PIC nuclear transport. PMID: 18032501 The 2.7A structure reveals that Hdj1 forms a homodimer in the crystal by a crystallographic two-fold axis. PMID: 18211704

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.