Recombinant Human Dna Repair Protein Rad50 (RAD50) Protein (His&Myc)

Name: Recombinant Human Dna Repair Protein Rad50 (RAD50) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06923P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Dna Repair Protein Rad50 (RAD50) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q92878
Target Symbol	RAD50
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLT
Expression Range	1-235aa
Protein Length	Partial
Mol. Weight	34.1 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11 to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.
Subcellular Location	Nucleus. Chromosome, telomere. Chromosome.
Protein Families	SMC family, RAD50 subfamily
Database References	HGNC: 9816 OMIM: 604040 KEGG: hsa:10111 STRING: 9606.ENSP00000265335 UniGene: PMID: 30176843 These data suggest that RAD50 foci formation in CTCs and CAMLs may be used to track cells subjected to radiation occurring at primary tumors, and following PD-L1 expression in circulating cells may be used as a surrogate for tracking adaptive changes in immunotherapeutic targets. PMID: 28679765 These evidences suggest that NBS1 is regulated by two kind of mechanisms: complex formation dependent on ATM, and protein degradation mediated by an unknown MG132-resistant pathway. PMID: 28369484 Five out of twelve patients with defects in either of MSH2, RAD50 and NBN genes suffered from rare life-threatening AE, more frequently than in control group (p = 0.0005). When all detected variants were taken into account, the majority of patients (8 out of 15) suffered from life-threatening toxicity during chemotherapy. PMID: 28376765 Low RAD50 expression is associated with low-grade epithelial ovarian cancer. PMID: 28073364 although recruitment of the MRE11-RAD50-NBS1 (MRN) DSB-sensing complex to viral genomes and activation of the ATM kinase can promote KSHV replication, proteins involved in nonhomologous end joining (NHEJ) repair restrict amplification of viral DNA. PMID: 28855246 Mre11-Rad50-Nbs1 complex initiates DNA double strand break repair. PMID: 28867292 symmetrical engagement of the Rad50 catalytic head domains with ATP bound at both sites is important for MRN functions in eukaryotic cells. PMID: 28369545 The results illuminate the important role of Nbs1 and CtIP in determining the substrates and consequences of human Mre11/Rad50 nuclease activities on protein-DNA lesions. PMID: 27814491 identification of a novel association for longevity in the RAD50/IL13 region on chromosome 5q31.1; the lead SNP rs2706372 is located in the intronic region of the RAD50 gene and is in strong linkage disequilibrium with other associated SNPs close to IL13 and IL5 PMID: 27004735 the structure of the human Rad50 hook and coiled-coil domains, was determined. PMID: 28134932 although Mre11 is required for efficient HR-dependent repair of ionizing-radiation-induced DSBs, Mre11 is largely dispensable for DSB resection in both chicken DT40 and human TK6 B cell lines. PMID: 27311583 The high expression of MRE11-RAD50-NBS1 complex constituents could be a predictor for poor prognosis and chemoresistance in gastric cancer PMID: 27798884 Germline mutation in RAD50 gene is associated with familial breast cancer. PMID: 26824983 The MRN complex is essential to restrain MYCN-induced replication stress during neural cell proliferation. PMID: 26068589 The C allele of rs6871536 was positively associated with atopic asthma in a Chinese population. PMID: 26493291 study identified the copy number deletion of RAD50 as a candidate marker for survival PMID: 27016230 Lack of association between RAD50-IL13 polymorphisms and pediatric asthma susceptibility in Northeastern Han Chinese PMID: 26365633 we present an in-depth genomic and functional genetic analysis identifying RAD50 hypomorphism as a contributing factor to a curative response to systemic combination therapy in a patient with recurrent, metastatic small-cell cancer. PMID: 24934408 a significant increase in DKC1, RAD50, MRE11 and RPA1 expression in MM cases with high bone marrow infiltration (p PMID: 26366868 RAD50 is required for ataxia-telangiectasia and Rad3-related (ATR) activation in mammalian cells in response to DNA replication stress. It is in turn phosphorylated at a specific site (S635) by ATR, which is required for ATR signaling through Chk1. PMID: 24694934 These results suggest that MRE11 is important in maintaining the structural arrangement of RAD50 in the protein complex and perhaps has a role in reinforcing proper alignment of the coiled coils in the ATP-bound state. PMID: 25828805 Furthermore, they collectively help to explain how MRN regulates DNA repair pathway choice. [review] PMID: 25576492 The results did not confirm the previously reported association between the RAD50 SNP Rs2237060 and the development of either common variable immunodeficiency or selective IgA deficiency. PMID: 26310047 ). We find that RAD50 and INPP4B expression levels have a synergistic influence on breast cancer survival, possibly through their effects on treatment response. PMID: 25528023 SNP (rs17166050) in RAD50 gene is associated with the susceptibility to acute lymphoid leukemia in children PMID: 26014697 This work demonstrates that the Mre11-Rad50-Nbs1 DNA repair complex positively regulates AAV replication and plays a role in the integration of adeno-associated airus in the presence of herpes simplex virus 1. PMID: 25903339 ATP switches the Mre11-Rad50-Nbs1 repair factor between signaling and processing of DNA ends. (Review) PMID: 25213441 Results suggest that BRCA1 participates in ALT through its interactions with RAD50 and BLM. PMID: 25084169 These data establish that MRE11A, RAD50, and NBN are intermediate-risk breast cancer susceptibility genes. PMID: 24894818 These results articulate a model of inhibition of adeno-associated virus gene expression in which physical interaction of viral DNA with Mre11/Rad50/Nbs1 complex is more important than enzymatic activity. PMID: 25320294 RAD50 abrogation impairs DNA damage response and sensitizes breast cancer cells to cisplatin-combined therapies. PMID: 24642965 this study reports a direct cytosolic interaction between the DNA-damage sensor Rad50 and the innate immune system adaptor CARD9. PMID: 24777530 Common genetic variations in the MRE11 and RAD50 genes do not contribute to an increased risk of laryngeal cancer. PMID: 24079363 The formerly reported sequence variants in the RAD50 and MRE11 gene may not constitute a risk factor of childhood ALL in Polish population. PMID: 24093751 Rad17 is phosphorylated by ATM at Thr622 resulting in a direct interaction of Rad17 with NBS1, facilitating recruitment of MRE11, RAD50 and ATM to the DNA double-strand breaks. PMID: 24534091 Immunohistochemistry was performed for MRE11, RAD50 and NIBRIN PMID: 23954013 The RAD50 gene was screened for mutations in well-characterized, Finnish, high-risk hereditary breast and/or ovarian cancer individuals. PMID: 21356067 The Mre11-Rad50-Nbs1 (MRN) complex further stimulates resection in the presence of Ku and DNA-PKcs by recruiting Exo1 and enhancing DNA-PKcs autophosphorylation, and it also inhibits DNA ligase IV/XRCC4-mediated end rejoining. PMID: 24220101 The association of asthma with variation near RAD50/IL13, first discovered in individuals of European ancestry, replicates in individuals of African ancestry. PMID: 23666277 Ataxia telangiectasia-mutated (ATM) kinase activity is regulated by ATP-driven conformational changes in the Mre11/Rad50/Nbs1 (MRN) complex. PMID: 23525106 Rad50 zinc hook is important for the Mre11 complex to bind chromosomal DNA double-stranded breaks and initiate various DNA damage responses PMID: 22833675 Adenovirus 5 regulates sumoylation of Mre11-Rad50-Nbs1 components through a paralog-specific mechanism. PMID: 22740413 The staining features of Rad50, a component of an essential DNA double-strand break repair complex, are clearly increased in melanoma cells with regards to both staining intensity and the number of positive melanoma cells PMID: 22725639 germline variants of RAD50 and NBS1 in non-BRCA1/2 high-risk families were not correlated with a breast cancer susceptibility in a cohort of Chinese women. PMID: 21811815 Carriers of the RAD50 haplotype may be susceptible to the DNA-damaging effects of radiation therapy associated with radiation-induced breast cancer. PMID: 21898661 Human Ku70/80 protein blocks exonuclease 1-mediated DNA resection in the presence of human Mre11 or Mre11/Rad50 protein complex. PMID: 22179609 RAD50, DNA-PKcs kinase activity, and transcription context are each important to limit incorrect end use during EJ repair of multiple DSBs, but each has distinct roles during repair events requiring end processing PMID: 22027841 Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance. PMID: 21734400 phosphorylation of Rad50 plays a key regulatory role as an adaptor for specific ATM-dependent downstream signaling through SMC1 for DNA repair and cell cycle checkpoint control in the maintenance of genome integrity. PMID: 21757780

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.