Recombinant Human Dna Repair Protein Complementing Xp-G Cells (ERCC5) Protein (His)

Name: Recombinant Human Dna Repair Protein Complementing Xp-G Cells (ERCC5) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09374P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Dna Repair Protein Complementing Xp-G Cells (ERCC5) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P28715
Target Symbol	ERCC5
Synonyms	COFS 3; COFS3; DNA excision repair protein ERCC 5; DNA excision repair protein ERCC-5; DNA excision repair protein ERCC5; DNA repair protein complementing XP G cells; DNA repair protein complementing XP-G cells; DNA repair protein complementing XPG cells; ERCC 5; ERCC5; ERCC5_HUMAN; ERCM 2; ERCM2; Excision repair cross complementation group 5; Excision Repair Cross Complementing Rodent Repair Deficiency; Excision repair cross complementing rodent repair deficiency complementation group 5; Excision repair protein; OTTHUMP00000064902; UVDR; Xeroderma Pigmentosum Complementation Group G; Xeroderma pigmentosum complementation group G protein; Xeroderma pigmentosum group G complementing protein; Xeroderma pigmentosum group G-complementing protein; XPG; XPG complementing protein; XPGC
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Expression Range	947-1186aa
Protein Length	Partial
Mol. Weight	30.8 kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Binds and bends DNA repair bubble substrate and breaks base stacking at the single-strand/double-strand DNA junction of the DNA bubble. Plays a role in base excision repair (BER) by promoting the binding of DNA glycosylase NTHL1 to its substrate and increasing NTHL1 catalytic activity that removes oxidized pyrimidines from DNA. Involved in transcription-coupled nucleotide excision repair (TCR) which allows RNA polymerase II-blocking lesions to be rapidly removed from the transcribed strand of active genes. Functions during the initial step of TCR in cooperation with ERCC6/CSB to recognized stalled RNA polymerase II. Also, stimulates ERCC6/CSB binding to the DNA repair bubble and ERCC6/CSB ATPase activity. Required for DNA replication fork maintenance and preservation of genomic stability. Involved in homologous recombination repair (HRR) induced by DNA replication stress by recruiting RAD51, BRCA2, and PALB2 to the damaged DNA site. During HRR, binds to the replication fork with high specificity and stabilizes it. Also, acts upstream of HRR, to promote the release of BRCA1 from DNA.
Subcellular Location	Nucleus. Chromosome.
Protein Families	XPG/RAD2 endonuclease family, XPG subfamily
Database References	HGNC: 3437 OMIM: 133530 KEGG: hsa:2073 STRING: 9606.ENSP00000347978 UniGene: PMID: 29148016 There is a multifarious interaction between the DNA repair gene ERCC5 SNPs (rs2094258 and rs873601) and the metabolic gene GSTP1 rs1695, which may form the basis for various inter-individual susceptibilities to atrophic gastritis in Chinese population. PMID: 29434449 this meta-analysis shows that XPG gene polymorphisms are associated with lung cancer and gastric cancer PMID: 28416771 Nine case-control studies involving 3540 cases and 3953 controls were included in the meta-analysis, which revealed that the XPG rs751402 polymorphism is positively associated with GC risk and could be viewed as a risk factor of GC in three genetic models. The XPG gene rs751402 polymorphism is associated with an increased risk of GC in Chinese Han populations. This fi nding should be veri fi ed by larger studies. PMID: 28832189 In NBEC, T allele at SNP rs2296147 upregulates ERCC5. PMID: 27235448 XPG gene polymorphism rs751402 was associated with increased susceptibility to gastric cancer in Chinese populations (Meta-Analysis) PMID: 29049208 Overexpression of human XPG and FEN1 increases genome instability in U2OS cells PMID: 28704715 This study showed that XPG rs2296147 CT/TT variants conferred significant survival disadvantage in CRC patients in term of PFS. PMID: 26887052 These results indicated that none of the selected XPG polymorphism could significantly alter gastric cancer susceptibility alone. PMID: 27929383 meta-analysis suggested that the rs873601 polymorphism was significantly associated with overall cancer risk. The moderate effects of rs751402 and rs2296147 polymorphism on cancer susceptibility might be highly dependent on cancer type and ethnicity, respectively PMID: 28796034 XPG mRNA expression was not predictive of trabectedin efficacy as single agent in hormone-positive, HER-2-negative advanced breast cancer. PMID: 27266804 the XPG gene rs2094258 C>T polymorphism may contribute to neuroblastoma susceptibility. PMID: 27019310 No strong evidence was found to support the use of XPG polymorphisms as tumor response and prognostic factors of patients with NSCLC receiving a platinum-based treatment regimen--(REVIEW) PMID: 28314991 Xpg thus helps to adequately induce DNA damage responses after IR, thereby keeping the expansion of damaged cells under control. This represents a new function of Xpg in the response to IR, in addition to its well-characterized role in nucleotide excision repair. PMID: 27137888 Meta-analysis indicated that the ERCC1 rs3212986 polymorphism and 2 polymorphisms in ERCC2 gene (rs13181 and rs1799793) contributed to the susceptibility of glioma. However, no association was observed between glioma risk and ERCC1 rs11615, ERCC2 rs238406, and ERCC5 rs17655 polymorphisms. PMID: 28514298 The rs751402 C/T SNP T allele and the T/T genotype were associated with an increased risk of GCA in younger individuals (>61 years) (odds ratio [OR] = 1.33 and 1.77, 95% confidence interval [CI] = 1.00-1.76 and 1.12-3.30, respectively). The rs873601 G/A SNP was not associated with susceptibility to GCA. PMID: 27228234 The ERCC5 rs751402 gene polymorphism may influence the susceptibility to gastric cancer in the Chinese population. PMID: 27706622 we found that XPG rs2094258, rs751402, and rs17655 do not influence the development of breast cancer in a Chinese population PMID: 27323134 The results from this meta-analysis indicate that the XPG gene Asp1104His polymorphism is associated with lung cancer risk, especially in Asians. PMID: 27323149 ). In conclusion, we suggest that the rs2094258 and rs751402 polymorphisms of ERCC5 are not connected to the development of this disease under codominant, dominant, and recessive models. PMID: 27323158 The ERCC5 promoter polymorphisms at -763 and +25 may be important functional variants and predictors of clinical outcome of advanced colorectal cancer patients who received oxaliplatin chemotherapy. PMID: 27175691 our study suggests that the rs17655 polymorphism in XPG is associated with an increased risk of gastric cancer. The results of our findings should be further validated by further large sample size studies PMID: 27323165 we suggest that the ERCC5 rs751402 polymorphism is associated with development of gastric cancer PMID: 27323183 ERCC5 single nucleotide polymorphism rs751402 is associated with breast cancer characteristics and risk in the Han population of northwest China. PMID: 25644244 The results indicate that XPG rs873601G>A polymorphism may be associated with the risk of stomach cancer. PMID: 26820236 GG genotype of rs17655 was correlated with an increased risk of gastric cancer compared to the CC genotype. rs1047768 and rs751402 were not significantly correlated with gastric cancer risk. PMID: 27051028 Results show that XPG partners with BRCA1 and BRCA2 to maintain genomic stability through homologous recombination, and its loss causes DNA breaks, chromosome aberrations, and replication fork stalling. PMID: 26833090 ERCC5 rs17655 polymorphism might contribute to genetic susceptibility to colorectal cancer. PMID: 26225711 XRCC1 Arg399Gln and XPG His46His might significantly affect the clinical outcomes of platinum-based chemotherapy. PMID: 24737519 our study indicated that ERCC5 rs2094258 polymorphism may contribute to the risk of breast cancer. PMID: 26045839 XPG Asp1104His polymorphism is a risk factor for head and neck cancer susceptibility. PMID: 25987016 the rs2296147 and rs2094258 polymorphisms of XPG, could be used as surrogate markers, leading to individualization of non-small cell lung cancer treatment strategies. PMID: 25729984 CDT2 mediated XPG elimination from DNA damage sites clears the chromatin space needed for repair. PMID: 25483071 Individuals that harbor uORF1 of ERCC5 have a marked resistance to platinum-based agents PMID: 26338418 conclusion, our findings suggest that XPG Asp1104His polymorphism may increase the susceptibility of CRC, especially in Asian populations. PMID: 25332048 Meta-analysis suggests that XPF Arg415Gln polymorphism may be associated with decreased lung cancer risk and XPG Asp1104His may be a low-penetrant risk factor in some cancers development. PMID: 24802942 Our data broaden the reported clinical spectrum of ERCC5 mutations and provide further evidence of genotype-phenotype correlation with truncating mutations being associated with severe phenotypes. PMID: 24700531 A novel mutation in ERCC5, causative of a pellagra-like condition linked to xeroderma pigmentosum/Cockayne syndrome complex. PMID: 24354460 This meta-analysis suggested that the XPG Asp1104His polymorphism was a risk factor for melanoma susceptibility. PMID: 25231183 Results found that polymorphisms in XPG rs2296147 and CSB rs2228526 were significantly associated with prostate cancer susceptibility in the Chinese population analyzed. PMID: 24615090 our study indicated that XRCC1 Arg399Gln and ERCC5 His46His might significantly influence the response to chemotherapy PMID: 24782167 The XPC rs2228000 TT genotype is associated with shorter overall survival in gastric cancer. PMID: 24990617 Three SNPs of XPG, rs2296147T>C, rs2094258C>T and rs873601G>A, were genotyped. PMID: 23464443 study provided statistical evidence that XPG rs2296147T>C and rs873601G>A polymorphisms may be used as surrogate markers toward individualizing non-small cell lung cancer treatment strategies PMID: 24615519 ERCC5 rs17655 polymorphism may not contribute to genetic susceptibility for lung cancer PMID: 24596032 The XPG gene polymorphism was also related to bladder cancer yet it was prevalent in female non-smokers. PMID: 23246108 polymorphisms in rs1047768 C/T and rs2296147 C/T are associated with response to platinum-based chemotherapy in advanced non-small-cell lung cancer, and XPG polymorphisms could be predictive of prognosis. PMID: 23621222 Homozygoty for the wild-type Asp1104 SNP of the ERCC5 gene was found in 2 cases of relapsed osteosarcoma, who responded to trabectedin. PMID: 24192772 XPG Asp1104His polymorphism was not associated with bladder cancer risk. PMID: 24061640 XPG polymorphisms are associated with response to chemotherapy in osteosarcoma. PMID: 23886164

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.