Recombinant Human DNA (DNMT3A) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-06370P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human DNA (DNMT3A) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-06370P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human DNA (DNMT3A) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9Y6K1
Target Symbol DNMT3A
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGESSAPGAASSGPTSIP
Expression Range 1-166aa
Protein Length Full Length
Mol. Weight 24.3 kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. It modifies DNA in a non-processive manner and also methylates non-CpG sites. May preferentially methylate DNA linker between 2 nucleosomal cores and is inhibited by histone H1. Plays a role in paternal and maternal imprinting. Required for methylation of most imprinted loci in germ cells. Acts as a transcriptional corepressor for ZBTB18. Recruited to trimethylated 'Lys-36' of histone H3 (H3K36me3) sites. Can actively repress transcription through the recruitment of HDAC activity. Also has weak auto-methylation activity on Cys-710 in absence of DNA.
Subcellular Location Nucleus. Chromosome. Cytoplasm.
Protein Families Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family
Database References

HGNC: 2978

OMIM: 602769

KEGG: hsa:1788

STRING: 9606.ENSP00000264709

UniGene: PMID: 29802960

  • Most had constantly high DNMT3A(mut) transcript levels. PMID: 28643785
  • Together findings presented here recognize an inherent role of MTA1 as a modifier of DNMT3a and IGFBP3 expression, and consequently, the role of MTA1-DNMT3a-IGFBP3 axis in breast cancer progression. PMID: 28393842
  • we developed a modular dCas9-SunTag (dC9Sun-D3A) system that can recruit multiple DNMT3A catalytic domains to a target site for editing DNA methylation. dC9Sun-D3A is tunable, specific, and exhibits much higher induction of DNA methylation at target sites than the dC9-D3A direct fusion protein. PMID: 29907613
  • Results indicate that DNMT3A mutations alone do not affect the clinical outcomes of AML patients undergoing allogeneic HSCT, but when accompanied by FLT3-ITD mutations, the OS was significantly reduced (5-year OS 0% for DNMT3A R882mut/FLT3-ITDpos patients vs. 62% DNMT3A R882wt/FLT3-ITDneg, p=0.025) and the relapse rate increased. PMID: 29786546
  • Genetic variation in DNMT3A gene is not associated with gastric cancer. PMID: 29956566
  • concluded that miR-876-5p suppressed hepatocellular carcinoma progression by targeting DNMT3A PMID: 29724530
  • These findings indicated a novel mechanism by which EID3, a p300 acetyltransferase inhibitor, could directly affect DNMT3A, this enzyme possesses dual methylation and demethylation abilities. PMID: 28074931
  • DNMT3A R882 mutation plays an important role in CN-AML patients' prognosis and clinical outcomes in the presence and absence of NPM1 and FLT3 mutations. PMID: 29079128
  • a feedback loop between miR-145 and DNMT3A is a potent signature for the Warburg effect in ovarian cancer, promising a potential target for improved anticancer treatment. PMID: 29993160
  • In univariable analysis, patients carrying mutations in DNMT3A, U2AF1, and EZH2 had worse overall and relapse-free survival. PMID: 29321554
  • Elastic Network Models, information theory, Protein Structure Network, and sequence evolution analysis were used to investigate intrinsic dynamics and allosteric properties of DNMT3A resolved in autoinhibitory and active states. The conformational transition between 2 states shows global motions. The dimer interface has a major role in defining the quaternary structure dynamics and establishing interdomain communication. PMID: 29674125
  • HIF1A-AS2 exerted the oncogenic functions in CRC through regulating miR-129-5p/DNMT3A axis. PMID: 29278853
  • we found that DNMT3A was responsible for the down-regulation of miR-105 in gastric cancer cells PMID: 28829505
  • Taken together, these data demonstrate that adipose Dnmt3a is a novel epigenetic mediator of insulin resistance in vitro and in vivo. PMID: 29091029
  • Low frequency of DNMT3A mutations in pediatric T-ALL is in striking contrast to adult T-ALL and renders the necessity for the search of other candidate prognostic markers. Combined Sanger sequencing-HRM approach offers a cost-effective option for genotyping DNMT3A coding sequence, with potential clinical application in other hematological malignancies. PMID: 28905428
  • 2.65-angstrom crystal structure of the DNMT3A-DNMT3L-DNA complex in which two DNMT3A monomers simultaneously attack two cytosine-phosphate-guanine (CpG) dinucleotides, with the target sites separated by 14 base pairs within the same DNA duplex; mechanistic basis for DNMT3A-mediated DNA methylation and establishment of its aetiological link to human disease PMID: 29414941
  • based on the investigation of previously reported variants in patients with Tatton-Brown-Rahman syndrome , we found overlap in the spectrum of DNMT3A variants observed in this disorder and somatic variants in hematological malignancies PMID: 28941052
  • The emodininduced downregulation of UHRF1 led to an increase in the level of DNA methyltransferase 3A. PMID: 28901428
  • Data suggest that miR-200b-3p may exhibit targeting and suppressive effects on DNA methyltransferase 3A (DNMT3A). PMID: 28345813
  • Prostaglandin E2 promotes the acquisition of DNMT3A-dependent tolerogenic functions in human myeloid-derived suppressor cells. PMID: 28978469
  • human mammary epithelial cells reprogramming is dependent on gene silencing by the DNA methyltransferase DNMT3A and loss of histone transcriptional marks following downregulation of the methyltransferase DOT1L. PMID: 28781076
  • the immunohistochemical expressions of Klotho and DNMT3a in tissues obtained from oral dysplasia and oral squamous cell carcinoma, is reported. PMID: 28303350
  • this epigenetic antagonism precedes malignant transformation and can be observed in preleukemic LSK cells from Idh2(R140Q) or Dnmt3a(R882H) single-mutant and Idh2(R140Q)/Dnmt3a(R882H) double-mutant mice. IDH/DNMT3A double-mutant acute myeloid leukemia (AML)manifested upregulation of a RAS signaling signature and displayed unique sensitivity to MEK inhibition ex vivo as compared with AMLs with either single mutation. PMID: 28408400
  • The current findings confirmed that downregulation of DNMT3A protein expression and the ensuing disturbance of the maintenance DNA methylation may serve an important role in the pathogenesis of early embryo growth arrest. PMID: 28560437
  • Our results provided novel insight into the role of the DNMT3A R882H mutation in AML pathogenesis and suggested that targeting the cellular GSH synthetic pathway could enhance the current therapy for AML patients with the DNMT3A R882H mutation. PMID: 28418922
  • data confirm MLL-PTD and, to a lesser extent, FLT3-ITD as common events in +11 AML.6, 7, 8 However, the high mutation frequencies of U2AF1 and genes involved in methylation (DNMT3A, IDH2) have hitherto not been reported in +11 AML PMID: 27435003
  • Silencing DNMT3A inhibits proliferation and invasion in ESCC cells by inducing demethylation of DOK7. PMID: 28343076
  • Data show that DNA methyltransferase 3A (DNMT3A) mutation was significantly associated with adverse outcome in addition to conventional risk stratification. PMID: 27359055
  • DNMT3A polymorphisms may be potential predictive markers for acute myelogenous leukemia patients' outcomes in China PMID: 27528035
  • this study shows that DNMT3A mutations are present in a significant proportion of SF3B1mut patients with RARS and its presence has a clearly negative impact on outcomes, determining a higher RBC transfusion dependency, higher risk of progression to AML, and lower OS. PMID: 27771989
  • DNMT3A is a de novo DNA methyltransferase that has recently gained relevance because of its frequent mutation in a large variety of immature and mature hematologic neoplasms. DNMT3A mutations are early events during cancer development and seem to confer poor prognosis to acute myeloid leukemia patients making this gene an attractive target for new therapies. [review] PMID: 28003281
  • the present cohort study demonstrated that FLT3-ITD and DNMT3A R882 double mutation predicts poor prognosis in Chinese AML patients receiving chemotherapy or allo-HSCT treatment. PMID: 28616699
  • propose a model of the DNMT3A PWWP domain-H3K36me3 complex and build a model of DNMT3A (PWWP-ADD-CD) in a nucleosomal context PMID: 26993463
  • DNMT3 mutation in OCI-AML3 strain enhances leukemic aggressiveness by promoting extramedullary infiltration process, which is partially through upregulating TWIST1. PMID: 27724883
  • Concurrent STAT3, DNMT3A, and TET2 mutations in T-LGL leukemia with molecularly distinct clonal hematopoiesis of indeterminate potential PMID: 27761930
  • No evidence for genetic variants in DNMT3A being implicated in cognitive performance decline in individuals with mild cognitive impairment. PMID: 27092400
  • A Methylated DNA Quantification Kit was used to quantify global DNA methylation, and single nucleotide polymorphisms (SNPs) in DNMT3A (rs36012910, rs1550117, and R882) and DNMT3B (rs1569686, rs2424909, and rs2424913) were identified using the restriction fragment length polymorphism method PMID: 28945286
  • DNMT3A1 and DNMT3A2V were detected in newly diagnosed acute myeloid leukemia (AML) patients and controls, with DNMT3A2V significantly up-regulated in AML patients. The main transcript switched from DNMT3A1 to DNMT3A2V in some patients, especially the low risk group based on the NCCN 2016 guidelines. These findings suggest that DNMT3A1 and DNMT3A2V are the main variants in AML. PMID: 29024628
  • Mechanical compression induced miR-9 downregulation by DNMT3A-dependent promoter methylation. PMID: 28252641
  • TP(thymidine phosphorylase ) curbed the expression of three proteins-IRF8, RUNX2, and osterix. This downregulation was epigenetically driven: High levels of 2DDR, a product of TP secreted by myeloma cells, activated PI3K/AKT signaling and increased the methyltransferase DNMT3A's expression. PMID: 27658717
  • alterations in DNMT3A and TET2 may be associated with acute myeloid leukemia prognosis PMID: 28992762
  • Mutation in the DNMT3A gene is associated with acute myeloid leukemia patients with lympho-myeloid clonal hematopoiesis. PMID: 27881874
  • These data demonstrate that haploinsufficiency for Dnmt3a alters hematopoiesis and predisposes mice (and probably humans) to myeloid malignancies by a mechanism that is not yet clear. PMID: 28872462
  • This report represents the first documentation of the same variant (DNMT3A p.Arg882His) as both the constitutional mutation associated with TBRS and the somatic mutation hotspot of AML. PMID: 27991732
  • Mutations in genes associated with epigenetic regulations such as DNMT3A and ASXL1 seem to play an important role in the pathogenesis of CML progression and TKI-resistance independent of ABL1 KD mutations PMID: 28667884
  • Dnmt3a2 is at the core of memory processes and represents a novel target for cognition-enhancing therapies to ameliorate anxiety and fear disorders and boost memory consolidation. PMID: 26598069
  • Data indicate that DNMT3A allele G of rs1550117 was associated with an increased risk of non-small cell lung cancer (NSCLC) susceptibility and binding affinity of transcription repressor SP1. PMID: 28423585
  • The results show that DNMT3A mutations are associated with an unfavourable clinical outcome in our Southeast Asian AML patient cohort. PMID: 28100593
  • DNMT3A mutations were rare in Chinese children with acute myeloid leukemia (AML). The mutation positions were different from the hotspots reported in adult AML. DNMT3A mutations may have adverse impact on prognosis of children with AML. PMID: 28767575
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed