Recombinant Human Dna-Directed Rna Polymerase Iii Subunit Rpc10 (POLR3K) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00499P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Dna-Directed Rna Polymerase Iii Subunit Rpc10 (POLR3K) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00499P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Dna-Directed Rna Polymerase Iii Subunit Rpc10 (POLR3K) Protein (His) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9Y2Y1 |
| Target Symbol | POLR3K |
| Synonyms | (RNA polymerase III subunit C10)(DNA-directed RNA polymerase III subunit K)(RNA polymerase III 12.5 kDa subunit)(RPC12.5)(RNA polymerase III subunit C11)(HsC11p)(RPC11)(hRPC11) |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | C-6His |
| Target Protein Sequence | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Expression Range | 1-108aa |
| Protein Length | Full Length |
| Mol. Weight | 15.1 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. |
| Subcellular Location | Nucleus, nucleolus. |
| Protein Families | Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family |
| Database References | HGNC: 14121 OMIM: 606007 KEGG: hsa:51728 STRING: 9606.ENSP00000293860 UniGene: PMID: 26288249 |
