Recombinant Human Dna-Directed Rna Polymerase I Subunit Rpa12 (ZNRD1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09950P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Dna-Directed Rna Polymerase I Subunit Rpa12 (ZNRD1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09950P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Dna-Directed Rna Polymerase I Subunit Rpa12 (ZNRD1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9P1U0 |
| Target Symbol | ZNRD1 |
| Synonyms | DNA directed RNA polymerase I subunit RPA12; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RNA polymerase I small specific subunit Rpa12; RPA12; RPA12_HUMAN; tctex 6; TCTEX6; TEX6; Transcription associated zinc ribbon protein; Zinc ribbon domain containing 1; Zinc ribbon domain containing protein 1; Zinc ribbon domain-containing protein 1; ZNRD1; ZR14 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS |
| Expression Range | 1-126aa |
| Protein Length | Full Length |
| Mol. Weight | 29.9kDa |
| Research Area | Transcription |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. |
| Subcellular Location | Nucleus, nucleolus. |
| Protein Families | Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family |
| Database References | HGNC: 13182 OMIM: 607525 KEGG: hsa:30834 STRING: 9606.ENSP00000331111 UniGene: PMID: 27166266 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
