Recombinant Human Dna-Directed Rna Polymerase I Subunit Rpa12 (ZNRD1) Protein (His-SUMO)

Name: Recombinant Human Dna-Directed Rna Polymerase I Subunit Rpa12 (ZNRD1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09950P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Dna-Directed Rna Polymerase I Subunit Rpa12 (ZNRD1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9P1U0
Target Symbol	ZNRD1
Synonyms	DNA directed RNA polymerase I subunit RPA12; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RNA polymerase I small specific subunit Rpa12; RPA12; RPA12_HUMAN; tctex 6; TCTEX6; TEX6; Transcription associated zinc ribbon protein; Zinc ribbon domain containing 1; Zinc ribbon domain containing protein 1; Zinc ribbon domain-containing protein 1; ZNRD1; ZR14
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Expression Range	1-126aa
Protein Length	Full Length
Mol. Weight	29.9kDa
Research Area	Transcription
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
Subcellular Location	Nucleus, nucleolus.
Protein Families	Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family
Database References	HGNC: 13182 OMIM: 607525 KEGG: hsa:30834 STRING: 9606.ENSP00000331111 UniGene: Hs.57813

Gene Functions References

Findings suggest a tumor suppressor function for ZNRD1 gene and a tumor contributor function for long noncoding RNAs (IncRNAs) ZNRD1-AS1 in the process of carcinogenesis of lung cancer. PMID: 27166266
ZNRD1 regulatory SNPs may be susceptibility makers for risk of both chronic HBV infection and HCC. PMID: 25110835
This study provides novel evidence that ZNRD1 polymorphism may confer host resistance to HIV-1 acquisition. PMID: 24842830
A miR-508-5p/ZNRD1/ABCB1 regulatory loop has a critical role in MDR in gastric cancer. PMID: 23893241
Variants in ZNRD1 gene predict HIV-1/AIDS disease progression in a Han Chinese population in Taiwan. PMID: 23874430
Nominal associations were found between ZNRD1 rs1150740 and risk of AERD via codominant and dominant genetic inheritance (P=.03; odds ratio, 1.14 [1.14-10.16]). PMID: 22697009
The results of human miRNA array and real-time PCR showed that ZNRD1 could significantly up-regulate the expression of miR-214 and down-regulate the expression of miR-296. PMID: 21080911
siRNA-based functional analysis showed that ZNRD1 down-regulation by siRNA or shRNA impaired HIV-1 replication at the transcription level in both lymphoid and nonlymphoid cells. PMID: 20192730
ZNRD1 gene displays high expression in VCR resistant gastric cancer cells. PMID: 12795835
overexpression of ZNRD1 could promote multidrug-resistant phenotype of gastric cancer cells through upregulation of P-glycoprotein PMID: 14726695
This study clearly demonstrates that ZNRD1 may play an important role in the control of human gastric cancer development by regulating cell proliferation. PMID: 15358150
ZNRD1 may play an important role in the regulation of gastric carcinogenesis and could be used as a new target in treatment of stomach cancer PMID: 15662122
ZNRD1 significantly inhibits the in vitro and in vivo growth of human gastric cancer cell line MKN28 by targeting cell cycle-related genes and reducing tumor angiogenesis. PMID: 17389617
The up-regulation of ZNRD1 significantly inhibited the drug sensitivity of gastric cancer cells over-expressing DARPP-32, indicating that ZNRD1 may be important in the DARPP-32-mediated MDR of gastric cancer PMID: 17492506
DARPP-32 mediates multidrug resistance of gastric cancer through regulation of P-gp and ZNRD1. PMID: 18058465
ZNRD1-expressing cells exhibited enhanced DNA repair capacity and overexpression could upregulate the expression of excision repair cross-complementing 1 (ERCC1) gene PMID: 18564169
ZNRD1 was down-regulated in esophageal cancer tissues compared to adjacent non-neoplastic tissues. PMID: 18594968

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.