Recombinant Human Dna-Binding Protein Inhibitor Id-1 (ID1) Protein (His-SUMO)

Name: Recombinant Human Dna-Binding Protein Inhibitor Id-1 (ID1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04318P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Dna-Binding Protein Inhibitor Id-1 (ID1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P41134
Target Symbol	ID1
Synonyms	bHLHb24; Class B basic helix-loop-helix protein 24; dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein); DNA binding protein inhibitor ID 1; DNA binding protein inhibitor ID1; DNA-binding protein inhibitor ID-1; Dominant negative helix loop helix protein; ID 1; ID; ID1; ID1_HUMAN; Inhibitor of Differentiation 1; Inhibitor of DNA binding 1; inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Expression Range	1-155aa
Protein Length	Full Length
Mol. Weight	32.1kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.
Subcellular Location	Cytoplasm. Nucleus.
Database References	HGNC: 5360 OMIM: 600349 KEGG: hsa:3397 STRING: 9606.ENSP00000365280 UniGene: PMID: 30066902 ID1, CTCF and ELK1 may be associated with prostate cancer, and may be potential therapeutic targets for the treatment of this disease. PMID: 29956775 CaMKII can directly phosphorylate Beclin 1 at Ser90 to promote K63-linked ubiquitination of Beclin 1 and activation of autophagy; it also promotes K63-linked ubiquitination of inhibitor of differentiation 1/2 (Id-1/2) by catalyzing phosphorylation of Id proteins and recruiting TRAF-6 PMID: 29079782 ID1 expression was associated with the proliferation, invasion and migration of SACC cells. The observed inhibition of SACC cell growth, invasion and migration following knockdown of ID1 expression in the present study, may have been due to restoration of the balance between oncogenic and tumor-suppressive effects resulting from changes in the expression of downstream genes or associated proteins. PMID: 29039489 The mutual correlation between the expression level of TWIST1 and ID1 might be a critical factor driving the process of the human odontoblasts' differentiation. PMID: 29159326 a loss of CULLIN3 represents a common signaling node for controlling the activity of intracellular WNT and SHH signaling pathways mediated by ID1 PMID: 27477274 Id1 enables lung cancer liver colonization by activating an epithelial mesenchymal transformation program in tumor cells and establishing the pre-metastatic niche. PMID: 28549790 High ID1 expression is associated with breast cancer. PMID: 27546618 ID1 expression impacts the sensitivity of colon cancer cells to 5-FU and may be considered as a potential predictive marker in colorectal carcinoma treatment. PMID: 28510612 Reducing ID1 gene expression reduces metastatic spread of salivary gland neoplasms. PMID: 27087608 High ID-1 expression is associated with colorectal carcinoma. PMID: 27633352 ID1 expression was positively related to drug resistance of EGFR-TKI in non-small cell lung cancer. PMID: 27978873 MVD was determined by immunohistochemistry, and the expressions of mRNA and protein of inhibitor of differentiation-1 (ID1) and vascular endothelial growth factor (VEGF) were detected in gastric cancer. PMID: 27610466 ID1 down-regulation induced parallel changes in the IGF and AKT pathways. The crosstalk of these pathways may enhance malignant phenotypes in salivary gland cancer. PMID: 27466488 Results show that ID1, ID3 and IGJ genes are highly expressed in adult B-ALL and correlate with poor prognosis in Hispanic patients. PMID: 27044543 Our findings define an intricate E2F1-dependent mechanism by which Id1 increases thymidylate synthase and IGF2 expressions to promote cancer chemoresistance. The Id1-E2F1-IGF2 regulatory axis has important implications for cancer prognosis and treatment. PMID: 26475334 Peritoneal VEGF-A expression is regulated by TGF-beta1 through an ID1 pathway in women with endometriosis PMID: 26577912 Id-1, a protein repressed by miR-29b, facilitates TGFbeta1-induced EMT in human ovarian cancer cells and represents a promising therapeutic target for treating ovarian cancer. PMID: 24662327 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients. PMID: 26858249 Id1 as an important modulator of molecular events during DPSC commitment and differentiation, which should be considered in dental research on tissue engineering. PMID: 24695670 Therefore, we identified a tumorigenic role of Id-1 in OS and suggested a potential therapeutic target for OS patients. PMID: 26797271 these findings provide in vivo genetic evidence of Id1 functions as an oncogene in breast cancer PMID: 25938540 ID1 overexpression may be associated with higher risk karyotype classification and act as an independent risk factor in young non-M3 acute myeloid leukemia patients. PMID: 26191235 Advanced melanoma patients, relative to healthy controls, express much higher levels of ID1 in myeloid peripheral blood cells. PMID: 25924227 LIF has a role in negatively regulating tumour-suppressor p53 through Stat3/ID1/MDM2 in colorectal cancers PMID: 25323535 Overexpression of ID1 is associated with colorectal neoplasia. PMID: 25623217 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity. PMID: 25778840 Four more genes (BMP4, BMPR1B, SMAD1 and SMAD4) of the ID1 pathway were investigated and only one (BMPR1B) shows the same down regulation PMID: 26072160 Smad1 as a novel binding protein of KSHV latency-associated nuclear antigen (LANA). LANA interacted with and sustained BMP-activated p-Smad1 in the nucleus and enhanced its loading on the Id promoters. PMID: 25010525 berberine's anti-proliferative and anti-invasive activities could be partially rescued by Id-1 overexpression in HCC models, revealing a novel anti-cancer/anti-invasive mechanism of berberine via Id-1 suppression. PMID: 25496992 NSCLC cells with high Id1 protein expression were vulnerable to the treatment of paclitaxel and cisplatin PMID: 25344919 We conclude that Id1 is potently angiogenic and can be up-regulated in endothelial progenitor cells PMID: 24620998 Id-1 and TGF-beta1 played important roles in the progression of gastric cancer, in which Id-1 might act as a downstream mediator of TGF-beta1 signaling through a regulatory mechanism involving N-cadherin and beta-catenin. PMID: 24861919 Downregulation of ID1 by gene silencing can lead to acceleration of TGF-beta1-induced hESC differentiation into ECs and inhibition of proliferation and migration of ECs. PMID: 25549282 Overexpression of ID1 in two different cell lines induced STMN3 and GSPT1 at the transcriptional level, while depletion of ID1 reduced their expression. PMID: 25028095 Our results suggest that Id1 promotes breast cancer metastasis by the suppression of S100A9 expression PMID: 24948111 This study elucidated the potential mechanism underlying Id1 participation in the progression of prostate cancer PMID: 25031707 Data indicate that grap2 and cyclin D1 interacting protein (GCIP) and inhibitor of of DNA binding/differentiation 1 (Id1) are inversely expressed in non-small cell lung cancer (NSCLC) cell lines and specimens. PMID: 24970809 ERbeta1 inhibits the migration and invasion of breast cancer cells and upregulated E-cadherin expression in a Id1-dependent manner. PMID: 25514034 High Id1b, generated by alternative splicing, maintains cell quiescence and confers self-renewal and cancer stem cell-like properties. PMID: 25449776 Data indicate that the inhibitor of DNA binding 1 (Id1)-IGF-II-IGF-IR-AKT signaling cascade plays an important role in esophageal cancer progression. PMID: 24599933 ID1 expression in pancreatic adenocarcinoma was associated with angiogenesis as measured by microvessel density. PMID: 24480377 Studies demostrated the regulatory role of ID1 in the proliferation and metastasis of colorectal cancer. PMID: 24804700 Results show that Id1 and NF-kappaB regulate the expression of CD133 and BMI-1 in an additive or synergistic manner in oral squamous cell carcinoma. PMID: 24572994 Higher Id1 mRNA expression levels might predict a higher hazard ratio for progression and a shorter disease-free survival in prostate cancer. PMID: 24129125 ID1 is a synthetic sick/lethal gene that interacts with the R175H TP53 mutant. PMID: 24378760 These results indicate that Id1 may down-regulate the ability of PC3 cells to form osteolytic lesions in vivo and the signal pathway needs to be further investigated. PMID: 22684559 Id1 induces mesenchymal-to-epithelial transition and pulmonary metastatic colonization by antagonizing Twist1 activity. PMID: 24332369 The results demonstrate that Id-1B decreases the malignancy of lung and prostate cancer cells and counteracts the protumorigenic role of the classical form of Id-1. PMID: 24295493 Inhibitor of differentiation 1 is a prognostic marker for multicentric Castleman's disease. PMID: 24599583

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Dna-Binding Protein Inhibitor Id-1 (ID1) Protein (His-SUMO)

Recombinant Human Dna-Binding Protein Inhibitor Id-1 (ID1) Protein (His-SUMO)

Product Overview

Target Details

FAQs