Recombinant Human Disco-Interacting Protein 2 Homolog A (DIP2A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01349P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Disco-Interacting Protein 2 Homolog A (DIP2A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01349P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Disco-Interacting Protein 2 Homolog A (DIP2A) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q14689 |
| Target Symbol | DIP2A |
| Synonyms | DIP2 homolog A |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | C-6His |
| Target Protein Sequence | EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS |
| Expression Range | 9-127aa |
| Protein Length | Partial |
| Mol. Weight | 18.9 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Catalyzes the de novo synthesis of acetyl-CoA in vitro. Promotes acetylation of CTTN, possibly by providing the acetyl donor, ensuring correct dendritic spine morphology and synaptic transmission. Binds to follistatin-related protein FSTL1 and may act as a cell surface receptor for FSTL1, contributing to AKT activation and subsequent FSTL1-induced survival and function of endothelial cells and cardiac myocytes. |
| Subcellular Location | Cell membrane; Peripheral membrane protein. Mitochondrion. Cell projection, dendritic spine. |
| Protein Families | DIP2 family |
| Database References | HGNC: 17217 OMIM: 607711 KEGG: hsa:23181 STRING: 9606.ENSP00000392066 UniGene: PMID: 26452339 |
