Recombinant Human Dihydropyrimidinase-Related Protein 4 (DPYSL4) Protein (His-GST&V5-Myc)
Beta LifeScience
SKU/CAT #: BLC-07194P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Dihydropyrimidinase-Related Protein 4 (DPYSL4) Protein (His-GST&V5-Myc)
Beta LifeScience
SKU/CAT #: BLC-07194P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Dihydropyrimidinase-Related Protein 4 (DPYSL4) Protein (His-GST&V5-Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O14531 |
Target Symbol | DPYSL4 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His-GST&C-V5-Myc |
Target Protein Sequence | TASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGVYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA |
Expression Range | 280-560aa |
Protein Length | Partial |
Mol. Weight | 66.8 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration. |
Subcellular Location | Cytoplasm. |
Protein Families | Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family |
Database References | HGNC: 3016 OMIM: 608407 KEGG: hsa:10570 STRING: 9606.ENSP00000339850 UniGene: PMID: 30061407 |