Recombinant Human Dihydropyrimidinase-Related Protein 2 (DPYSL2) Protein (His)

Name: Recombinant Human Dihydropyrimidinase-Related Protein 2 (DPYSL2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03221P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DPYSL2.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Dihydropyrimidinase-Related Protein 2 (DPYSL2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q16555
Target Symbol	DPYSL2
Synonyms	Collapsin response mediator protein 2; Collapsin response mediator protein; Collapsin response mediator protein hCRMP 2; CRAM; CRMP 2; CRMP-2; CRMP2; DHPRP 2; DHPRP2; Dihydropyrimidinase 2; Dihydropyrimidinase like 2; Dihydropyrimidinase like 2 long form; Dihydropyrimidinase related protein 2; Dihydropyrimidinase-related protein 2; DPYL 2; DPYL2; DPYL2_HUMAN; DPYSL 2; Dpysl2; DRP-2; DRP2; Musunc 33; Musunc33; N2A3; TOAD 64; TOAD64; ULIP 2 protein; ULIP-2; Ulip2; Unc-33-like phosphoprotein 2
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
Expression Range	1-572aa
Protein Length	Full Length
Mol. Weight	64.3kDa
Research Area	Developmental Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.
Subcellular Location	Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Membrane. Note=Tightly but non-covalently associated with membranes.
Protein Families	Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family
Database References	HGNC: 3014 OMIM: 602463 KEGG: hsa:1808 STRING: 9606.ENSP00000309539 UniGene: PMID: 27940916 crystal structure of human tetrameric CRMP-2 PMID: 28044206 increased pCRMP2 may underlie the axonal pathology of Lewy body dementias. PMID: 27609071 These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells PMID: 26555036 polymorphisms of the DPYSL2 gene in humans may be associated with the development of schizophrenia. PMID: 25847191 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling PMID: 25416705 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs. PMID: 25224486 Reduced CRMP2 expression and elevated expression of nuclear phosphorylated CRMP2 may be associated with breast cancer progression. PMID: 23381229 Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2. PMID: 24634145 High dihydropyrimidinase-related protein 2 expression is associated with lung cancer. PMID: 24518087 genetic variants in DPYSL2 may play a role in susceptibility to alcohol dependence. PMID: 23846846 A specific and reversible intermolecular Cys-504-Cys-504 dithiol-disulfide switch in homotetrameric CRMP2 determines two conformations of the quaternary CRMP2 complex that controls axonal outgrowth and thus neuronal development. PMID: 24133216 CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2. PMID: 24036111 a novel regulatory mechanism that utilizes CRMP2 SUMOylation to choreograph NaV1.7 trafficking. PMID: 23836888 a new insight into CRMP-2 as a controller of myosin II-mediated cellular functions through the inhibition of ROCK II in nonneuronal cells PMID: 22431514 No Alzheimer disease-associated differences in CNP and DPYSL2 promoter DNA methylation were observed. PMID: 22954668 Deletion analysis of CRMP-2 identified a 51 amino acid sequence in the C-terminus that is required for targeting to the basal body and primary cilium. This domain contains GSK-3beta phosphorylation sites. PMID: 23185275 High levels of nuclear phosphorylated CRMP-2 is associated with lung cancer. PMID: 23023514 CRMP2 hyperphosphorylation is speci fi c to Alzheimer's disease and is not a common event in all forms of dementia and neurodegeneration, especially other tauopathies. PMID: 21860090 findings suggest a major role of phosphorylated CRMP-2 as a mechanism involved in process retraction induced by reactive oxygen species PMID: 22443207 HTLV-1 has the capacity to influence the CRMP2/PI3K/Akt axis thus to positively control cytoskeleton organization and lymphocyte migration. PMID: 22227566 CRMP2 controls dendritic projection; the phosphorylation of CRMP2 at Ser522 is essential for proper dendritic field organization for axonal guidance and spine development . PMID: 22279220 This review discusses the essential biology of CRMP2 in the context of nascent data implicating CRMP2 perturbations as either a correlate of, or plausible contributor to, diverse neuropathologies. PMID: 21271304 Data support DPYSL2 and the surrounding genomic region as a susceptibility locus for schizophrenia. PMID: 21302347 Data provide the first trafficking regulatory role for Crmp2 in non-neuronal cells and support a model in which Crmp2 is an important endocytic regulatory protein that links MICAL-L1.EHD1-based vesicular transport to dynein motors. PMID: 20801876 DPYSL2 does not have a major function in schizophrenia in Japanese subjects. PMID: 20414250 CRMP2 as a tubulin direct binder may be a GTPase-activating protein (GAP) of tubulin in neurite formation and its GAP activity may be regulated by an intramolecular interaction with an N-terminal inhibitory region. PMID: 19666111 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain. PMID: 11771764 No significant associations were found between five polymorphisms of the DRP-2 gene and Bipolar Disorder, nor were associations detected between either of the polymorphisms and bipolar subtypes I and II. PMID: 12951196 Here we show that glial cell line-derived neurotrophic factor (GDNF) enhances CRMP-2 expression in TGW human neuroblastoma cells via activation of RET receptor tyrosine kinase. PMID: 15207709 significant decrease of crmp-2 protein may represent or underlie impaired neuronal plasticity, neurodegeneration, wiring of the brain in mesial temporal lobe epilepsy PMID: 15672539 CRMP-2 transports the Sra-1/WAVE1 complex to axons in a kinesin-1-dependent manner and thereby regulates axon outgrowth and formation PMID: 16260607 collapsin response mediator protein-2 transcriptional activity is inhibited by all-trans-retinoic acid during SH-SY5Y neuroblastoma cell differentiation PMID: 17229153 These observations implicate hyperphosphorylation of CRMP2 as an early event in the development of AD and suggest that it can be induced by a severe APP over-expression and/or processing defect. PMID: 17683481 results indicate that that CRMP-2 may be a novel colorectal cancer biomarker PMID: 18203259 association of neurofibromin and CRMP-2 is essential for neuronal cell differentiation PMID: 18218617 relative resistance to phosphatases might be a common feature of Cdk5 substrates and could contribute to the hyperphosphorylation of CRMP2 and Tau observed in Alzheimer disease PMID: 18460467 Data suggest that collapsin response mediator protein-2 (CRMP-2) is a novel calmodulin-binding protein and that CaM binding may play an important role in regulating CRMP-2 functions. PMID: 19151921 Given that CRMP-2 is a key regulator of axon elongation, this interference with cytoplasmic dynein function by CRMP-2 might have an important role in axon formation, and neuronal development PMID: 19659462 A significant association was found between a single nucleotide polymorphism of the DRP-2 gene and schizophrenia in a North American sample. PMID: 15858820

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.