Recombinant Human Dihydropyrimidinase-Related Protein 1 (CRMP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04541P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRMP1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRMP1.
Recombinant Human Dihydropyrimidinase-Related Protein 1 (CRMP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04541P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Dihydropyrimidinase-Related Protein 1 (CRMP1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q14194 |
Target Symbol | CRMP1 |
Synonyms | Collapsin response mediator protein 1; CRMP 1; CRMP-1; Crmp1; Dihydropyrimidinase like 1; Dihydropyrimidinase related protein 1; Dihydropyrimidinase-related protein 1; DPYL1_HUMAN; DPYSL1; DRP 1; DRP-1; DRP1; ULIP-3; Ulip3; Unc-33-like phosphoprotein 3 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG |
Expression Range | 1-572aa |
Protein Length | Full Length |
Mol. Weight | 78.2kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis. |
Subcellular Location | Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Cell projection, growth cone. Cytoplasm, cytoskeleton. Perikaryon. |
Protein Families | Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family |
Database References | |
Tissue Specificity | Brain. |
Gene Functions References
- Study provides a novel insight into the relevance of collapsin response mediator protein 1, a key molecule in semaphorin-3A signaling during neurodevelopment, in the molecular mechanism of action of lithium, and in the pathophysiology of bipolar disorder. PMID: 29666369
- Study shows that CRMP1 acts an EMT and metastasis suppressor in prostate cancer cells via its regulation of actin polymerization. PMID: 27321179
- Identify CRMP-1 as a novel regulator of actin filament elongation and reveal a surprisingly important role for CRMP-1, EVL, and actin polymerization in maintaining the structural integrity of epithelial sheets. PMID: 28630144
- The present study reports that miR-187 was significantly overexpressed in gastric cancer tissues compared to that in non-tumor tissues and was associated with malignant clinical factors such as depth of invasion (P = 0.005), tumor size (P = 0.024), lymph node metastasis . It was found that collapsin response mediator protein 1 (CRMP1), a tumor suppressor, was a direct downstream target of miR-187. PMID: 27864146
- miR200a-3p promotes the proliferation of human esophageal cancer cells by post-transcriptionally regulating CRMP1. PMID: 28025999
- CRMP1 interacted with Spy1 which would disturb the association of CRMP1 with actin and was involved in the collapse of growth cones induced by Sema3A and regeneration after sciatic nerve crush. PMID: 25526860
- These results demonstrate an important role for CRMP-1 in Listeria actin comet tail formation and open the possibility that CRMP-1 controls cell motility by modulating Arp2/3 activation. PMID: 26598519
- Human CRMP-1 comprises a tetrameric assembly. PMID: 26249678
- Results show that expression of CRMP1 is downregulated in medulloblastoma (MB) tumors. its overexpression inhibits proliferation, migration and invasion of cells suggesting that CRMP1 is implicated in MB pathogenesis. PMID: 26009886
- Aberrant upregulation of CRMP-1 expression may link to the mechanism of developing early-onset preeclampsia. PMID: 25194153
- CRMP1 targets aggregation-prone, N-terminal HTT fragments and suppresses their spontaneous self-assembly. PMID: 25908449
- The mitochondrial fragmentation protein DRP1 play a role in the development of malignant melanoma. PMID: 26032958
- in pilocarpine-induced animal model of epilepsy, CRMP-1 dynamically decreased in a range of 2 months. Thus, our results indicate that CRMP-1 may be involved in the development of TLE PMID: 22359051
- CRMP1 is a novel candidate protein for schizophrenia traits PMID: 22798627
- GSK3beta-dependent phosphorylation of LCRMP-1 provides an important mechanism for regulation of LCRMP-1 on cancer cell invasiveness and clinical outcome. PMID: 22363707
- LCRMP-1 and CRMP-1 have opposing functions in regulating cancer cell invasion and metastasis PMID: 21747164
- Data demonstrate that CRMP1 tyrosine 504 is a primary target of the Src family of tyrosine kinases (SFKs), specifically Fyn. PMID: 20506281
- LCRMP-1 was a cancer invasion enhancer that could be a novel prognostic biomarker in non-small cell lung cancer. PMID: 19362386
- CRMP-1 and CRMP-2 have a role in RhoA-dependent signaling, through interaction with and regulation of ROKalpha PMID: 12482610
- Collapsin response mediator protein-1: a novel invasion-suppressor gene. PMID: 12650609
- CTGF inhibits metastasis and invasion of human lung adenocarcinoma by a CRMP-1-dependent mechanism. PMID: 14996858
- CRMP1 and EVC genes are located near WFS1, the Wolfram syndrome type 1 gene. PMID: 15492864
- The CRMP1 protein is characterizing as modulators of Wnt protein signaling of Axin-1. PMID: 16169070
- GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms PMID: 16611631
- The collapsin response mediator protein 1 and the promyelocytic leukemia zinc finger protein interact with UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE). PMID: 17118363
- Transcription of the invasion suppressor, CRMP-1, is reciprocally regulated at the promoter region by C/EBPalpha and Sp1. PMID: 18524846
- ChIP and EMSA demonstrated that p50 binds to a kappaB site residing between -1753 and -1743 of the CRMP-1 promoter region. PMID: 18782567
- loss of CRMP1 contribute to the increased invasive phenotype of human Glioblastoma multiforme brain tumors expressing mutant EGFRvIII. PMID: 19903856