Recombinant Human Dickkopf-Related Protein 1 (DKK1) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05727P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody , the EC 50 is 1.283-2.544 ng/mL.
Recombinant Human Dickkopf-Related Protein 1 (DKK1) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05727P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Dickkopf-Related Protein 1 (DKK1) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody , the EC50 is 1.283-2.544 ng/mL. |
| Uniprotkb | O94907 |
| Target Symbol | DKK1 |
| Synonyms | (Dickkopf-1)(Dkk-1)( hDkk-1)(SK) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-10His |
| Target Protein Sequence | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
| Expression Range | 32-266aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 28.5 kDa |
| Research Area | Cardiovascular |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity. |
| Subcellular Location | Secreted. |
| Protein Families | Dickkopf family |
| Database References | HGNC: 2891 OMIM: 605189 KEGG: hsa:22943 STRING: 9606.ENSP00000363081 UniGene: PMID: 30116403 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
