Recombinant Human Desmoglein-3 (DSG3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04344P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Desmoglein-3 (DSG3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04344P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Desmoglein-3 (DSG3) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P32926
Target Symbol DSG3
Synonyms 130 kD pemphigus vulgaris antigen; 130 kDa pemphigus vulgaris antigen; Balding; Cadherin family member 6; CDHF 6; CDHF6; Desmoglein 3; Desmoglein 3 precursor; Desmoglein-3; Desmoglein3; DKFZp686P23184; DSG 3; DSG3; DSG3_HUMAN; Pemphigus vulgaris antigen; PVA
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence IAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVISRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFNDNCPTAVLEK
Expression Range 70-499aa
Protein Length Partial
Mol. Weight 64.0kDa
Research Area Cell Adhesion
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
Subcellular Location Cell membrane; Single-pass type I membrane protein. Cell junction, desmosome.
Database References

HGNC: 3050

OMIM: 169615

KEGG: hsa:1830

STRING: 9606.ENSP00000257189

UniGene: PMID: 27346727

  • our findings suggest that Dsg3 functions as a key in cell-cell adhesion through at least a mechanism of regulating E-cadherin membrane trafficking PMID: 27254775
  • Desmoglein 3 Order and Dynamics in Desmosomes PMID: 29212005
  • Data indicate that all 3 monoclonal antibodies (mAbs) targeted the same extracellular cadherin (EC) domain on desmoglein 3 (Dsg3), caused Dsg3 internalization in primary keratinocytes, and caused suprabasal blisters in skin. PMID: 27304671
  • DSG3 was a key prognostic factor and predictor for neoadjuvant concurrent chemoradiotherapy response in rectal cancer patients. PMID: 27040321
  • Treg cells exert a clear down-regulatory effect on the Dsg3-driven T-cell response and, accordingly, the formation of Dsg3-specific IgG antibodies PMID: 26661498
  • Data identify DSG3 as a negative prognostic biomarker in resected pancreatic ductal adenocarcinoma, as high DSG3 expression is associated with poor overall survival and poor tumour-specific survival. PMID: 26469831
  • this study directly demonstrates the occurrence of desmoglein 3 molecules outside of desmosomes and reveales that the adhesive properties of these molecules do differ depending on their localization. PMID: 25510735
  • DSG2 and DSG3 might be potential diagnostic markers for squamous cell carcinoma of the lung and DSG3 could be a potential differentiation marker for lung cancer. PMID: 25468811
  • alterations of their expression suggest a role of Dsg3 and gamma-catenin (additionally to E-cadherin/beta-catenin) as biomarkers of malignant transformation risk of oral dysplasia and the biological behavior (aggressiveness) of oral cancer, respectively PMID: 23430339
  • the Dsg3 epitopes targeted by pathogenic mPV IgG are human specific in mice PMID: 25695683
  • Pemphigus vulgaris is characterized by low IgG reactivities to specific self-antigens along with high IgG reactivity to desmoglein 3. PMID: 24820664
  • High DSG3 mRNA expression is associated with esophageal squamous cell carcinoma. PMID: 24568510
  • Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of PKP3 and its detachment from DSG3. PMID: 24328683
  • Dsg3 did not associate with rafts in cells lacking desmosomal proteins. PMID: 24498201
  • this study identifies a novel Dsg3-mediated c-Jun/AP-1 regulatory mechanism and PKC-dependent Ezrin phosphorylation that could be responsible for Dsg3-associated cancer metastasis. PMID: 23752190
  • DSG3 functions as an oncogene and facilitates cancer growth and invasion in head and neck cancer cells PMID: 23737966
  • The conformational Dsg3 ELISA index reflected the pathogenicity of anti-Dsg3 antibodies more accurately than the conventional Dsg3 ELISA index in pemphigus vulgaris. PMID: 23602628
  • MAC387 and desmoglein-3 are reliable diagnostic markers for supporting the morphologic impression of squamous differentiation in urinary bladder carcinoma. PMID: 23806524
  • All 3 markers were studied independently and were associated with tumor percentage in metastatic lymph nodes. PVA had the strongest correlation, followed by PTHrP and then TACSTD1. PMID: 23625795
  • provide a proof of principle supporting that ultrasensitive nanostructured assay systems for DSG3 can be exploited to detect micrometastatic HNSCC lesions in lymph nodes, which can improve the diagnosis PMID: 23010602
  • The cis-adhesive interface on extracellular subdomain EC1 recognized by the pathogenic antibody PVA224 is the primary target of the autoantibodies present in the serum of pemiphigus vulgaris patients. PMID: 22996451
  • an important novel function for Dsg3 in promoting actin dynamics through regulating Rac1 and Cdc42 activation in epithelial cells. PMID: 22796473
  • a useful immunohistochemical marker for differentiation of lung squamous cell carcinoma and adenocarcinoma from other subtypes PMID: 22495379
  • In paraneoplastic pempigus and pemphigus vulgaris, IgG autoantibodies to DSG3 may be found in autoantibody profiling. PMID: 22318391
  • Report mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides. PMID: 22261006
  • These findings suggest a novel function for Dsg3 in the control of E-cadherin-Src signalling and cell-cell adhesion. PMID: 22294297
  • These data indicate a contribution of Dsg depletion to pemphigus vulgaris pathogenesis dependent on Ca(2+)-induced differentiation. PMID: 21864491
  • Silencing desmoglein 3 caused defects in cell-cell adhesion and concomitant reduction in cell proliferation in both HaCaT and MDCK cells. PMID: 21702856
  • Dsg3, as an up-stream regulator of Src activity, helps regulate adherens junction formation through its interaction with E-cadherin PMID: 21151980
  • The genetic background of the local population may explain why pemphigus occurs more commonly than bullous pemphigoid in Northwestern Romania compared with the population of Western Europe PMID: 20618495
  • results argue against the hypothesis that DSG3 coding variants play a role in pemphigus vulgaris susceptibility PMID: 19678820
  • Data strongly support the view that desmoglein 3 contributes to the regulation of epidermal differentiation. PMID: 12138195
  • The appearance of DSG3-reactive Th2 cells is constant at different stages of pemphigus vulgaris (PV), while DSG3-reactive Th1 cells are detected at a significantly higher frequency in chronic active PV. PMID: 12496453
  • In trichilemmal keratinization in follicle, and in cysts in these areas, desmoglein 3 expressed throughout outer root sheath and cyst wall. In areas of epidermal-like keratinization, desmoglein 3 expression was limited mainly to the basal layer. PMID: 12787134
  • a novel negative marker for epidermal stem cell-containing population of keratinocytes PMID: 12953062
  • Dsg3(AA145-192)-specific cells preferentially utilize the TCRVbeta13 gene, while Dsg3(AA240-303)- and Dsg3 (AA570-614)-specific cells utilize Vbeta7 and Vbeta17 genes, respectively PMID: 14675184
  • The five genes, and three of the encoded proteins, were shown differentially expressed between a group of keratoconus patients and a reference group using different techniques PMID: 16015083
  • Dsg3 endocytosis, keratin filament retraction, and the loss of keratinocyte cell-cell adhesion are coordinated responses to PV IgG PMID: 16377623
  • autoantibodies against desmoglein 3 (Dsg3) have been detected in sera from patients with fogo selvagem PMID: 16763546
  • analysis of desmoglein 3 ectodomain in pemphigus vulgaris PMID: 16842599
  • Overexpression of DSG3 is associated with head and neck cancer PMID: 16878157
  • Desmoglein 3 status indicated a poor prognosis in lung cancers. PMID: 17084439
  • The T cellular autoimmune response against immunodominant peptides of Dsg3 in patients with pemphigus vulgaris is monitored with highly specific HLA-DRbeta1*0402 tetramers. PMID: 17113829
  • These data indicate that Dsg3(dim) populations from primary human adult keratinocytes and long-term established keratinocyte lines possess certain stem/progenitor cell-like properties. PMID: 17255524
  • Data suggest that although the desmoglein (Dsg)3 depletion is not indicative for adhesive strength, it may indicate pathogenic changes within the cell and it plays a role in skin fragility or susceptibility to blister formation in pemphigus patients. PMID: 17428808
  • Reduction of Dsg3 might be relevant to blister formation in pemphigus vulgaris. PMID: 17431647
  • pemphigus vulgaris-IgG-dependent uPA activation is not related to anti-Dsg3 antibody activity PMID: 17532189
  • Autoantibody from pemphigus vulgaris sera react with non-conformational epitopes of desmoglein 3. PMID: 18095943
  • results indicate that the membrane proximal region in the IA region of Dsg3 is necessary for complex formation with P120-catenin and to maintain free Dsg3 at the cell surface before it is integrated into desmosomes PMID: 18343367
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed