Recombinant Human Deleted In Azoospermia-Like (DAZL) Protein (His-GST&V5-Myc)

Name: Recombinant Human Deleted In Azoospermia-Like (DAZL) Protein (His-GST&V5-Myc)
Brand: Beta LifeScience
SKU: BLC-07196P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Deleted In Azoospermia-Like (DAZL) Protein (His-GST&V5-Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q92904
Target Symbol	DAZL
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-V5-Myc
Target Protein Sequence	VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR
Expression Range	130-250aa
Protein Length	Partial
Mol. Weight	50.2 kDa
Research Area	Developmental Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	RRM DAZ family
Database References	HGNC: 2685 OMIM: 601486 KEGG: hsa:1618 STRING: 9606.ENSP00000250863 UniGene: Hs.131179
Tissue Specificity	Testis specific.

Gene Functions References

computational analysis of free energy change due to this point mutation using GROMOS96 indicated decreased stability of the DAZL protein. The N109T variant in an infertile male population may provide a genetic marker for mutational analysis of DAZL PMID: 28388287
Data suggest that DAZL may be one such factor in human female fertility PMID: 26989066
Through the translational regulation of novel RNA targets SMC1B and TEX11, DAZL may have a key role in regulating chromosome cohesion and DNA recombination; two processes fundamental in determining oocyte quality and whose establishment in foetal life may support lifelong fertility. PMID: 28364521
hypermethylation of DAZL and BOULE promoters in human sperm is associated with human infertility PMID: 27358391
data can be used to further elucidate the role of NANOS3 and DAZL in germ cell development both in vitro and in vivo PMID: 27768780
DAZL was not expressed either in normal cultures or lesions from cervixes with papillomavirus infections and cervical intraepithelial neoplasia. PMID: 25491317
analysis demonstrated that SNP260 of DAZL did not contribute to oligo/azoospermia while SNP386 was correlated to male infertility PMID: 25994644
Neither the A260G nor the A386G polymorphism of DAZL appeared to be involved in male infertility. PMID: 25323654
analysis of T12A and T54A polymorphisms role in the development of male infertility (Meta-Analysis) PMID: 24717865
demonstrate that Boll is also transiently expressed during oogenesis in the fetal mouse ovary, but is simultaneously co-expressed within the same germ cells as Dazl PMID: 24086306
Abnormal DNA methylation of the DAZL promoter might represent an epigenetic marker of male infertility. PMID: 24015185
Amniotic fluid-derived stem cells (AFSc) seem to express Nodal, Nanog and DAZL and it speculated that the regulation of self-renewal in AFSc could be similar as in human embryonic stem cells. PMID: 24459810
The A260G and A386G polymorphisms of the DAZL gene are not correlated with astheno-teratozoospermia-induced male infertility in the Han Chinese population. PMID: 23678708
study identified the core promoter of the DAZL gene; also provided preliminary evidence for the role of a novel SNP of the DAZL gene promoter in spermatogenic failure PMID: 22752612
overexpression of VASA and or DAZL, in both embryonic and induced pluripotent stem cells promoted differentiation into primordial germ cells, and maturation and progression through meiosis was enhanced. PMID: 22162380
results showed no significant differences in the frequency of DAZL AG (P = 0.58) and MTHFR CT (P = 0.44) between oligozoospermic infertile men and controls PMID: 22329245
These results suggest that incorrect epigenetic marks in germline gene DAZL may be correlated with male gametogenic defects. PMID: 20685756
386A-->G was significantly correlated with sperm count (P<0.0001) and motility (P<0.005) and 584+28c-->t was marginally correlated with sperm morphology. PMID: 20462796
expression of spermatogenic phenotypes of partial AZFc deletions is independent of the variations in DAZL and BOULE in the Han population PMID: 19342699
Dazl contributes to the differentiation of embryonic stem cells into germ cells. PMID: 20008336
Results suggest that DAZL-expressing (DE)cells, which possess some pluripotent/multipotent characteristics of ES cells express OCT-4 and SOX-2 genes, can be easily isolated from blood. PMID: 19327014
role of the autosomal candidate gene DAZLA (Deleted in AZoospermia Like Autosome) in male subfertility PMID: 11499325
The DAZL transcript and protein are present in human spermatozoa. PMID: 11872225
The distinct expression pattern of DAZL protein in the corpus luteum may play an important role in the regulation of luteal function. PMID: 12029071
These findings confirm that DAZL and DAZ can only substitute for early functions of the murine homologue resulting in the establishment of the germ cell population and partial progression into meiosis PMID: 12200456
findings provide strong evidence for the role of the autosomal DAZL gene in human spermatogenesis PMID: 12414900
Data suggest that the T54A polymorphism of deleted-in-azoospermia-like (DAZL) protein might play a role in infertility only in Taiwanese or Asiatic individuals. PMID: 15220464
In a Caucasian population, the DAZL SNP (single nucleotide polymorphism) 386 is completely absent and SNP 260 is not associated with spermatogenic failure and therefore does not represent a molecular marker for genetic diagnosis of male infertility. PMID: 15520024
PUM2 and DAZL, are capable of binding the same mRNA sequences in the 3'UTR of human SDAD1 mRNA. PMID: 15607425
DAZL transcripts are present in the last stages of oocyte maturation, in embryoic cell stems, and throughout the preimplantation development. PMID: 15879466
DAZL activates translationally silent mRNAs during germ cell development through the direct recruitment of polyA-binding proteins. PMID: 16001084
The Thr54-->Ala polymorphism in exon 3 of DAZL has no major role in Japanese males with azoospermia or oligozoospermia. PMID: 16123080
SNPs in the DAZL gene may act jointly to affect common reproductive characteristics in the human population. PMID: 16328470
study demonstrates the absence of the A386G (T54A) mutation in Indian subcontinent and two mutations A260G (T12A) and A437G (I71V) are polymorpic... these mutations in the DAZL gene are not associated with male infertility in Indian subcontinent PMID: 16573709
Novel missense mutations of DAZL may be associated with age at menopause and/or sperm count and warrant further biochemical and genetic investigation. PMID: 16884537
Our results suggest that human amniotic fluid represents a new source for the isolation of human DAZL-, C-kit-, SSEA-4-, and Oct-4-positive stem cells without raising the ethical issues associated with human embryonic research. PMID: 18023443
In ovarian extracts a marked increase in expression of DAZL mRNA and protein occurred in the 2nd trimester. PMID: 18088417
Follicle-stimulating hormone receptor and DAZL gene polymorphisms do not affect the age of menopause. PMID: 18178196

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.