Recombinant Human Deleted In Azoospermia-Like (DAZL) Protein (His-GST&V5-Myc)
Beta LifeScience
SKU/CAT #: BLC-07196P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Deleted In Azoospermia-Like (DAZL) Protein (His-GST&V5-Myc)
Beta LifeScience
SKU/CAT #: BLC-07196P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Deleted In Azoospermia-Like (DAZL) Protein (His-GST&V5-Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q92904 |
| Target Symbol | DAZL |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-GST&C-V5-Myc |
| Target Protein Sequence | VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
| Expression Range | 130-250aa |
| Protein Length | Partial |
| Mol. Weight | 50.2 kDa |
| Research Area | Developmental Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | RRM DAZ family |
| Database References | HGNC: 2685 OMIM: 601486 KEGG: hsa:1618 STRING: 9606.ENSP00000250863 UniGene: PMID: 28388287 |
