Recombinant Human Cytotoxic T-Lymphocyte Protein 4 (CTLA4) Protein (hFc), Active



Recombinant Human Cytotoxic T-Lymphocyte Protein 4 (CTLA4) Protein (hFc), Active
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Back to school. back to lab. ready for results. - advance your research with beta lifescience, Co-inhibitory receptors, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Cytotoxic T-Lymphocyte Protein 4 (CTLA4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE and HPLC. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody, the EC 50 of human CD152 protein is 27.14-34.82 ng/ml. |
Uniprotkb | P16410 |
Target Symbol | CTLA4 |
Synonyms | CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF |
Expression Range | 37-162aa |
Protein Length | Partial |
Mol. Weight | 42.5 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Note=Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalization. |
Database References | HGNC: 2505 OMIM: 109100 KEGG: hsa:1493 STRING: 9606.ENSP00000303939 UniGene: PMID: 29409002 |