Recombinant Human Cytomegalovirus Viral Interleukin-10 Homolog (UL111A) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-07885P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cytomegalovirus Viral Interleukin-10 Homolog (UL111A) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-07885P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cytomegalovirus Viral Interleukin-10 Homolog (UL111A) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | F5HC71 |
| Target Symbol | UL111A |
| Species | Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) |
| Expression System | E.coli |
| Tag | N-10His-SUMO |
| Target Protein Sequence | ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK |
| Expression Range | 26-176aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 36.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. |
| Subcellular Location | Secreted. |
| Protein Families | IL-10 family |
| Database References | KEGG: vg:3077506 |
Gene Functions References
- Authors show that the previously observed downregulation of hsa-miR-92a and upregulation of CCL8 during human cytomegalovirus latent infection of myeloid cells are intimately linked via the latency-associated expression of cytomegalovirus UL111A. PMID: 25253336
- These results suggest a significant and wide-ranging role for cmvIL-10 in the progression of breast cancer. PMID: 24520416
- cIL-10 expressing CD4 T-cells are directed against latently expressed US28 and UL111A. PMID: 24130479
- This study identifies a novel role for viral IL-10 in driving M2c polarization, which may limit virus clearance by restricting proinflammatory and CD4(+) T cell responses at sites of infection. PMID: 23864618
- CmvIL-10 bound avidly to the same receptors on blood mononuclear cells and was as bio-potent as native human IL-10. PMID: 21402594
