Recombinant Human Cytokine Receptor Common Subunit Gamma (IL2RG) Protein (His)
Recombinant Human Cytokine Receptor Common Subunit Gamma (IL2RG) Protein (His)
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Christmas & new year research sale — 30% off storewide, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Cytokine Receptor Common Subunit Gamma (IL2RG) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P31785 |
| Target Symbol | IL2RG |
| Synonyms | IL2RG; Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | C-6His |
| Target Protein Sequence | PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
| Expression Range | 56-254aa(N75Q) |
| Protein Length | Partial |
| Mol. Weight | 25.0 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cell surface. |
| Protein Families | Type I cytokine receptor family, Type 5 subfamily |
| Database References | HGNC: 6010 OMIM: 300400 KEGG: hsa:3561 STRING: 9606.ENSP00000363318 UniGene: PMID: 29388853 |
