Recombinant Human Cytokine-Like Protein 1 (CYTL1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01705P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cytokine-Like Protein 1 (CYTL1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01705P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Cytokine-Like Protein 1 (CYTL1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9NRR1 |
Target Symbol | CYTL1 |
Synonyms | Protein C17 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR |
Expression Range | 23-136aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 20.8 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Subcellular Location | Secreted. |
Database References | |
Tissue Specificity | Specifically expressed in CD34+ hematopoietic cells. |
Gene Functions References
- Circular dichroism analysis showed that, like chemokines, CYTL1has a higher content of beta-sheet than alpha-helix secondary structure; recombinant CYTL1 promoted calcium flux in chondrocytes; unlike chemokines, CYTL1 had limited affinity to proteoglycans; together, these properties further support cytokine-like properties for CYTL1 with some overlap with the chemokines PMID: 28478073
- this study shows that CYTL1 possesses chemotactic activity and demonstrates that its functional receptor is CCR2B PMID: 27084102
- when the native signal peptide of CYTL1 was replaced by IgGkappaSP, the expression and secretion was increased by 4 fold. PMID: 26922322
- role in regulation embryo implantation PMID: 26800213
- Cytl1 is highly expressed in the endometrium during the embryo implantation and its expression is regulated by ovarian hormones. Cytl1 enhances endometrial proliferation, induces the secretion of endometrial LIF and HB-EGF, and even enhances endometrial cell adhesion to trophoblastic cells. These indicate that Cytl1 is a potential molecular mediator of embryo is a potential molecular mediator in embryo implantation. PMID: 26800213
- our results showed the first evidence of CYTL1 expression in SH-SY5Y neuroblastoma cells and human NB tissues, revealed a possible link between CYTL1 and NB development PMID: 22797702
- evidence suggests that ANKRD7 and CYTL1 genes may play an important role in the variance in alcohol drinking risk PMID: 22613542
- C17orf62-L could induce cell death accompanied with rising of cleaved PARP. PMID: 21503106
- The DNA methylation pattern of the CYTL1 promoter region was significantly different between early and advanced stages of squamous cell carcinoma. PMID: 22011669
- C17 as a cytokine that s contributes to immune homeostasis systemically or in a tissue-specific manner in the joint PMID: 21799806
- We report a structural-functional characterization of cytokine-like protein 1 (Cytl1) by a combination of different computational structure-based techniques. PMID: 21322034