Recombinant Human Cytochrome P450 2C9 (CYP2C9) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04902P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cytochrome P450 2C9 (CYP2C9) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04902P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cytochrome P450 2C9 (CYP2C9) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P11712 |
| Target Symbol | CYP2C9 |
| Synonyms | (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; CP2C9_HUMAN; CPC9; CYP2C; CYP2C10; CYP2C9; CYPIIC9; cytochrome P-450 S-mephenytoin 4-hydroxylase; Cytochrome P-450MP; Cytochrome P450 2C9; Cytochrome P450 MP-4; Cytochrome P450 MP-8; Cytochrome P450 PB-1; Cytochrome P450; family 2; subfamily C; polypeptide 9; Cytochrome p4502C9; flavoprotein-linked monooxygenase; MGC149605; MGC88320; microsomal monooxygenase; OTTHUMP00000020135; P450 MP; P450 PB 1; P450 PB1; P450IIC9; P450MP; S mephenytoin 4 hydroxylase; S-mephenytoin 4-hydroxylase; xenobiotic monooxygenase |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG |
| Expression Range | 1-162aa |
| Protein Length | Full Length of Isoform 2 |
| Mol. Weight | 25.4 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids and steroids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. Exhibits low catalytic activity for the formation of catechol estrogens from 17beta-estradiol (E2) and estrone (E1), namely 2-hydroxy E1 and E2. Catalyzes bisallylic hydroxylation and hydroxylation with double-bond migration of polyunsaturated fatty acids (PUFA). Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan. |
| Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
| Protein Families | Cytochrome P450 family |
| Database References | HGNC: 2623 OMIM: 601130 KEGG: hsa:1559 STRING: 9606.ENSP00000260682 UniGene: PMID: 29746595 |
