Recombinant Human Cytochrome P450 2C19 (CYP2C19) Protein (His&Myc)

Name: Recombinant Human Cytochrome P450 2C19 (CYP2C19) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-04867P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cytochrome P450 2C19 (CYP2C19) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P33261
Target Symbol	CYP2C19
Synonyms	(R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; CP2CJ_HUMAN; CPCJ; CYP2C; CYP2C19; CYPIIC17; CYPIIC19; Cytochrome P-450 II C; Cytochrome P450 2C19; Cytochrome P450; subfamily IIC (mephenytoin 4-hydroxylase); polypeptide 19; Cytochrome P450-11A; Cytochrome P450-254C; Flavoprotein-linked monooxygenase; Mephenytoin 4 hydroxylase; Mephenytoin 4-hydroxylase; Microsomal monooxygenase; P450-11A; P45011A; P450C2C; S-mephenytoin 4-hydroxylase; Xenobiotic monooxygenase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
Expression Range	26-490aa
Protein Length	Full Length of Mature Protein
Mol. Weight	60.6 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	A cytochrome P450 monooxygenase involved in the metabolism of polyunsaturated fatty acids (PUFA). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates PUFA specifically at the omega-1 position. Catalyzes the epoxidation of double bonds of PUFA. Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Responsible for the metabolism of a number of therapeutic agents such as the anticonvulsant drug S-mephenytoin, omeprazole, proguanil, certain barbiturates, diazepam, propranolol, citalopram and imipramine. Hydroxylates fenbendazole at the 4' position.
Subcellular Location	Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Protein Families	Cytochrome P450 family
Database References	HGNC: 2621 OMIM: 124020 KEGG: hsa:1557 STRING: 9606.ENSP00000360372 UniGene: PMID: 29738309 The CYP2C19 phenotype is not predicted by the number of functional alleles of CYP2C19 and CYP3A4 genes. PMID: 29733119 CYP2C192 genotype-guided antiplatelet treatment remained a cost-effective strategy. PMID: 28117433 CYP2C19 SNP was significantly associated with high on-treatment platelet reactivity and clinical outcomes after percutaneous coronary intervention. PMID: 29352151 Polymorphisms of the CYP2C19 is associated with Adverse Drug Reactions of Voriconazole among Hematological Patients after Allo-Hematopoietic Stem Cell Transplantation. PMID: 28685218 In a subject with predicted CYP2C19 PM phenotype, the PK of BMS-823778 was affected significantly by UGT1A4 polymorphism. PMID: 29311135 Wild-type CYP2C191B and 30 isoforms were highly expressed in insect cells, and the enzymatic activities of CYP2C19 variants towards nebivolol hydroxylation were characterized. Three variants, CYP2C1929 (K28I), L16F, and CYP2C1923 (G91R), showed increased intrinsic clearance of >140% CYP2C191B. PMID: 29098786 Carriage of a combination of mutant alleles in multiple genes including ITGB3+CYP2C192 or CYP2C192 + ITGA2 or CYP2C192 are possible predictors of CVE in patients after CABG PMID: 29461866 Gene polymorphism testing results indicated that patients with CYP2C193 had a significantly higher incidence of high on-treatment platelet reactivity. PMID: 29397568 CYP2C19 genotype only partially determines the CYP2C19 phenotypic appearance. PMID: 29665549 appears that 5azaDC treatment affects an unidentified upstream regulator of both CYP2C19 and/or NR1I3. This is supported by the fact that the relationships between TF for CYP2C19 and the expression of this target gene in human liver samples only accounted for approximately 70% of the variability of CYP2C19 mRNA levels. PMID: 28840784 For percutaneous coronary intervention in postoperative patients, research data is still lacking regarding clopidogrel dosage on the basis of different CYP2C19 genotypes. PMID: 28164572 Even heterozygous CYP2C192 allele carriers among Caucasian patients after ischemic stroke had a higher risk of major adverse clinical events. PMID: 29509167 results obtained from this study have proven the CYP variants to be immunoreactive and spectrally active and are suitable for use to examine biotransformation and interaction mechanism of the enzymes PMID: 29524040 Report association of CYP2C19 genotype with bleeding in Serbian STEMI patients who have undergone primary PCI and treatment with clopidogrel. PMID: 29260275 Personalized treatment with clopidogrel or ticagrelor based on CYP2C19 genotype status ultimately led to improved clinical outcomes in acute coronary syndrome patients treated with percutaneous coronary intervention. PMID: 29243114 CYP2C192 Polymorphism is associated with drug resistance in Breast Cancer. PMID: 29479969 Comparisons of pharmacokinetics of 25 substrates CYP2C9, CYP2C19, or CYP2D6 in healthy Chinese and European subjects (classified with same enzyme activity) suggest that, for most substrates, limited interethnic pharmacokinetic differences exist (according to the databases used in this study). (CYP2C9 = cytochrome P450 family 2 subfamily C member 9; CYP2D6 = cytochrome P450 family 2 subfamily D member 6) PMID: 29181698 We documented a different effect of CYP2C19 and P2Y12 receptor polymorphisms on platelet reactivity and cardiovascular outcome in coronary artery disease patients after percutaneous coronary intervention on clopidogrel treatment. Importantly, increased platelet reactivity adversely affects the cardiovascular outcome independently of the studied polymorphisms. PMID: 28329746 CYP2C192 and elevated BMI are associated with clopidogrel HTPR. However, CYP2C192 genotyping doesn't predict clopidogrel response sufficiently. PMID: 28802144 Results suggest a role of cytochrome P450 2C19 (CYP2C19) gene variants as a potential marker of Clopidogrel response. PMID: 29347970 There is an association between cyp2c19 and loss of function allele status of clopidrogrel for stroke risk reduction PMID: 29979852 The identified allele frequencies were CYP2C191 (64.33%), 2 (31.06%) and 3 (4.61%). The major prevalent genotype combinations were CYP2C19 1/1 (41.73%) and 1/2 (39.65%). In the Hakka population, frequencies of the CYP2C19 2 and 3 variants were observed to be close to those previously identified in Chinese and several other Asian populations. PMID: 29288619 CYP2C19 polymorphisms significantly impacted systemic exposure and metabolism pathways of BMS-823778 in humans. PMID: 28850715 Human but not rat liver proteins immunoblotting allowed us to characterize the novel LM antibodies and to identify CYP-2C19 as human antigen PMID: 29279846 The frequency of primary outcome was significantly higher in patients carrying CYP2C192 AG/AA genotype receiving PPIs compared with the same genotype in those not receiving PPIs. The PPIs used in patients carrying CYP2C192 AG/AA was independently associated with the primary outcome after adjusting for other risk factors. PMID: 27637911 PPI therapy in children with 17 alleles may be better optimized with CYP2C19 genotype-guided dosing prior to pH probe testing. PMID: 28884817 Patients with CYP2C192 were at increased risk and CYP2C192, CYP3A53 and GSTP1 have synergistic influence on CYC failure. PMID: 28976264 Consensus has yet to be reached on which CYP2D6 and CYP2C19 star alleles to include on pharmacogenetic testing panels and pharmacogenetic results reporting could be considerably improved PMID: 28777243 The impact of CYP2C19 genetic polymorphisms on the efficacy of proton pump inhibitor-based triple eradication therapy in Slavic patients appears significant. PMID: 29889439 A total of 42.0% carried >/=1 CYP2C192 allele. PMID: 28745576 Implementing a CYP2C19 genotype-guided approach to antiplatelet therapy. PMID: 28745582 Among children with medically refractory GERD despite proton pump inhibitor therapy, carriage of CYP2C1917 allele corresponding to the extensive metabolizer phenotype was associated with need for anti-reflux surgery. PMID: 29209919 Patients with an acute coronary event and a very poor, poor and normal CYP2C19 metabolizer genotype have a higher prevalence of diabetes mellitus needing insulin than patients with the rapid and ultrarapid metabolizers CPY2C19 genotype. PMID: 28473221 In addition to the CYP2C19 genotype as predictive factors. PMID: 28834922 no association was identified between the CYP2C19()2 variant and the development of coronary in-stent restenosis. PMID: 28785581 CYP2C19 genetic polymorphisms had significant influence on the antiplatelet effect of clopidogrel and clinical outcomes in patients with intracranial aneurysms treated with stent-assisted coiling. PMID: 27634953 The ultrarapid-metabolizing 17 allele of CYP2C19 (OMIM 124020), which is common in Europeans and Africans and rare in Asians, results in higher circulating concentrations of VNO. We hypothesized that LTRs with the 17 allele would have an increased risk for voriconazole-associated SCC. PMID: 26982740 This gastric juice-based real-time PCR assay is a more accurate method for detecting H. pylori infection, clarithromycin susceptibility and CYP2C19 polymorphisms. The method may be employed to inform the choice of proton pump inhibitor (PPI), clarithromycin and amoxicillin treatment for tailored H. pylori eradication therapy PMID: 28638276 This study showed that distinct genetic markers were associated with phenotype-specific PHT-induced severe cutaneous adverse drug reactions. HLA-B13:01, HLA-B56:02/04, and CYP2C193 were potential genetic markers of phenytoin-induced drug rash with eosinophilia and systemic symptoms/drug hypersensitivity syndrome in Thai patients. PMID: 28391407 The present study aimed to assess the effects of CYP2C19 gene polymorphisms on proton pump inhibitor (PPI), amoxicillin, and levofloxacin triple therapy for Helicobacter pylori (Hp) eradication. PMID: 28577017 efficacy of clopidogrel for the prevention of ischemic stroke in post-coronary stent patients may be reduced by the insufficiency of the CYP2C19 gene PMID: 29188612 These data highlight the potential relevance of CYP2C19 pharmacogenetics in influencing NorEND concentrations in tamoxifen-treated patients, which may influence treatment outcomes PMID: 26799162 We compared the carrier frequency of Cytochrome P450 Enzymes and Transport Proteins markers among the Russian population living in Moscow with Dagestan ethnic groups. Statistically significant differences for the following gene polymorphisms: CYP2C1917, CYP2C93, ABCB1 (C3435T), SLCO1B15 were found between the Russian population and the three ethnic groups of the Dagestan republic. PMID: 29023140 SNP rs4244285 of CYP2C19 tended to be associated with decreased risk of essential hypertension. PMID: 28513222 CYP2C19 polymorphism analysis may improve treatment decisions in patients with ACS receiving DES-PCI PMID: 29279531 Our results suggest that CYP2C19 LOF alleles (2 and 3) significantly impact the prognosis of patients on clopidogrel therapy after CAS and that the CYP2C192 and CYP2C193 alleles have the same effects on prognosis PMID: 27137706 Behcet's disease patients had lower CYP2C19 enzyme activity and lower frequency of the CYP2C1917 allele as compared to those of the healthy controls. PMID: 27875029 CYP2C19 polymorphism does not affect rosuvastatin pharmacokinetics in healthy Taiwanese in a clinically meaningful way. PMID: 27128002 On-treatment platelet reactivity was compared between patients stratified by diabetes mellitus (DM), CYP2C192 status and clopidogrel dose. Both DM and CYP2C19*2 were independently associated with elevated on-treatment platelet reactivity with clopidogrel 75 mg daily. PMID: 27009617

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.