Recombinant Human Cytochrome P450 2A13 (CYP2A13) Protein (His&Myc)

Name: Recombinant Human Cytochrome P450 2A13 (CYP2A13) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06562P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cytochrome P450 2A13 (CYP2A13) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q16696
Target Symbol	CYP2A13
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR
Expression Range	1-494aa
Protein Length	Full Length
Mol. Weight	64.1 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N,N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Possesses phenacetin O-deethylation activity.
Subcellular Location	Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Protein Families	Cytochrome P450 family
Database References	HGNC: 2608 OMIM: 608055 KEGG: hsa:1553 STRING: 9606.ENSP00000332679 UniGene: PMID: 27567546 The results of this case-control study suggested that the CYP2A131/2 genotype decreased the risk of susceptibility to bladder cancer in Japanese smokers PMID: 27725446 CYP2A13 levels in human lungs can be suppressed by disease-associated inflammation in tissue donors. PMID: 25710941 an etiologically relevant interaction between CYP2A13 and ABCB1 associated with lung cancer was analysed PMID: 25667220 The transgenic CYP2A13 is active. PMID: 24907355 CYP2A13 played a critical role in AFB1-induced neoplastic transformation. PMID: 24114584 Data suggest important role of CYP2A13 in AFG1- (aflatoxin G1)-induced cytotoxicity, DNA damage, and activation of signal pathways in bronchial epithelium; data suggest similarities in CYP2A13-catalyzed bioactivation of AFG1 and AFB1 (aflatoxin B1). PMID: 23907605 CYP2A13 is efficient in 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone bioactivation in vivo and it can mediate 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone-induced lung tumorigenesis. PMID: 23917075 Findings suggest the potential involvement of pulmonary CYP2A13 in the early occurrence of NSCLC as well as in the development of EGFR gene mutations. PMID: 23752126 an efficient approach for expressing functionally characterized, highly active and homogeneous CYP2A13 proteins. PMID: 23463547 CYP2A13 plays an important role in low-concentration AFB1-induced DNA damage, possibly linking environmental airborne AFB1 to genetic injury in the human respiratory system. PMID: 23583631 Findings suggest that CYP2A13 plays an important role in low-concentration AFB1-induced DNA damage, possibly linking environmental airborne AFB1 to genetic injury in human respiratory system. PMID: 23602888 The differential distribution pattern of CYP2A13 in the respiratory tract, which is of importance in considering the pulmonary susceptibility to carcinogens and the following lung cancer development, is detailed. PMID: 22890016 Tissue distribution of transgenic mRNA expression agrees well with the known respiratory tract-selective expression of CYP2A13 and CYP2F1 and hepatic expression of CYP2B6 in humans. PMID: 22397853 Report selective expression of CYP2A13 in human pancreatic alpha-islet cells. PMID: 22798551 Although both the hepatic CYP2A6 and respiratory CYP2A13 enzymes metabolize these compounds, CYP2A13 does so with much higher catalytic efficiency, but the structural basis for this has been unclear PMID: 22700965 The distribution frequencies of all eight known CYP2A13 missense alleles were examined in a Chinese Han population. PMID: 22315333 present results provide the first direct in vitro evidence demonstrating the predominant roles of CYP2A13 in 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK)-induced mutagenesis, possibly via metabolic activation of NNK alpha-hydroxylation PMID: 21473878 single nucleotide polymorphisms within the CYP2A13 gene affect metabolism of 5-methoxypsoralen in humans. PMID: 20798279 2 novel polymorphisms T478C and T494C in CYP2A13 gene were associated with significantly reduced risk of cancer. CYP2A13 haplotype carrying variant alleles of T478C/T494C found associated with reduced risk of head/neck cancer. PMID: 20534012 significant interaction between smoking and methylation status of CYP2A13 in head and neck cancer. PMID: 20846153 The mechanisms underlying the decreased allelic expression of a common CYP2A13 allele (7520C>G) in the human lung, were investigated. PMID: 20431511 Observed clear prevalence of the variant CYP2A13 alelle causing premature stop at codon 101 (knockout allele 7) among the controls in comparison with the pancreatic cancer patients. PMID: 19812523 genetic polymorphism: identification of single-nucleotide polymorphisms and functional characterization of an Arg257Cys variant PMID: 12130698 CYP2A13 allele is associated with reduced risk of lung adenocarcinoma, suggesting the role of NNK-CYP2A13 interaction as a causative factor for the cancer. PMID: 14633739 In order to investigate the extent of CYP2A13 genetic polymorphism in a French Caucasian population of 102 individuals, a screening for sequence variations in the 5'-untranslated and protein encoding regions of its gene was performed. PMID: 15063809 The CYP2A13 Arg257Cys variant represents a common polymorphism in Chinese, with the 257Cys allele frequency being similar to the Hispanic and Asian groups, but significantly lower than in blacks PMID: 15115698 CYP2A13 mutant proteins showed a significant decrease in the catalytic efficiency for NNK alpha-hydroxylation PMID: 15333516 structure of CYP2A13 was determined to 2.35A by x-ray crystallography and compared with structures of CYP2A6. PMID: 17428784 the reported association of the CYP2A13()2 allele with decreased incidences of lung adenocarcinoma in smokers can be at least partly explained by a decrease in CYP2A13 function PMID: 18669584

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.