Recombinant Human Cytochrome P450 11B2, Mitochondrial (CYP11B2) Protein (His-SUMO)

Name: Recombinant Human Cytochrome P450 11B2, Mitochondrial (CYP11B2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02895P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cytochrome P450 11B2, Mitochondrial (CYP11B2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P19099
Target Symbol	CYP11B2
Synonyms	ALDOS; Aldosterone synthase; Aldosterone-synthesizing enzyme; C11B2_HUMAN; CYP11B2; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Cytochrome P450 11B2; Cytochrome P450 11B2; mitochondrial; mitochondrial; P-450Aldo; P-450C18; Steroid 18-hydroxylase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Expression Range	25-503
Protein Length	Full Length of Mature Protein
Mol. Weight	71.0kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone. Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21-hydroxyprogesterone, namely 11-beta hydroxylation followed with two successive oxidations at C18 to yield 18-hydroxy and then 18-aldehyde derivatives, resulting in the formation of aldosterone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin).
Subcellular Location	Mitochondrion inner membrane; Peripheral membrane protein.
Protein Families	Cytochrome P450 family
Database References	HGNC: 2592 OMIM: 103900 KEGG: hsa:1585 STRING: 9606.ENSP00000325822 UniGene: PMID: 29229168 The research reveals that among patients with essential hypertension treated with hypotensive drugs there are certain relationships between the rs5182 and rs5186 polymorphisms of the AGTR1 gene, as well as between the rs1799998 polymorphism of the CYP11B2 gene and the volume of the carotid bodies. PMID: 29627490 Frequencies and distribution of genotype TT of CYP11B2 (C-344T) gene polymorphism among South African Black women, especially those without HIV infection, may prevent them from developing preeclampsia. PMID: 29523271 Aldosterone-producing adenomas (APAs) exhibit different patterns of CYP11B2 staining that vary from uniform to homogeneous. Approximately 30% of patients with unilateral hyperaldosteronism do not have an APA, but either have an increased number of CYP11B2 expressing micronodules or hyperplasia of the zona glomerulosa. [review] PMID: 29202495 In conclusion, our meta-analysis indicated that subjects with TT genotype might have higher risk of developing LVH in northern Han Chinese. PMID: 28692307 study demonstrated significant genetic interaction on Na intake with child obesity by salt-sensitive genes variations, NEDD4L and CYP11beta2 PMID: 28017963 The combination of the V386A mutation with the variant CYP11B2 173(Arg) only slightly reduces the 18-hydroxylase and 18-oxidase activity, whereas the V386A mutation with the CYP11B2 173(Lys) variant almost abolishes the 18-hydroxylation and 18-oxidation. In both cases the 11-hydroxylase activity is not affected. PMID: 28190867 The AG genotype frequency of single nucleotide polymorphism rs542092383 was significantly associated with an increased risk of Essential Hypertension among northern Han Chinese. PMID: 28953657 the cellular distribution of CYP11B2, CYP11B1, CYP17A1 and KCNJ5 in adrenals from two familial hyperaldosteronism type 3 siblings, was examined. PMID: 27793677 Aging is associated with a pattern of decreased normal zona glomerulosa CYP11B2 expression. PMID: 28566337 CYP11B2 methylation was found in patients with aldosterone producing adenomas. PMID: 27754862 In European continental ancestry patients the C allele (CC or CT) at -344T/C SNP in the aldosterone synthase gene does not significantly influence clinical prognosis of chronic heart failure. PMID: 28625318 his study provided candidates for novel drug-like CYP11B2 inhibitors by molecular simulation methods for the hypertension treatment. PMID: 27781210 Suggest that there is lack of association between -344T/C polymorphism of CYP11B2 gene and coronary heart disease in Malaysian population. PMID: 25890613 Our study is aimed at evaluating the contribution of CYP11B2 promoter methylation to the risk of essential hypertension(EH). Our findings suggest that gene-environment interactions are associated with the pathogenesis and progression of EH PMID: 28078278 The present study revealed a strong synergistic effect of CYP11B2 C-344T and IC polymorphisms causing susceptibility to EHT and haplotype H1 (-344T-Conv-Lys173) as the risk-conferring factor for hypertension predisposition. PMID: 27935319 Deletions, duplications or chimeric CYP11B2/CYP11B1 gene is associated with 11beta-hydroxylase deficiency. PMID: 26280318 CYP11B2 T-344C single nucleotide polymorphism exhibited a strong association with the development of coronary artery disease in Taiwanese women. PMID: 26941570 aldosterone synthase (CYP11B2) gene polymorphism may contribute to diabetic nephropathy development, especially in Asian group, with the T allele acting as a risk factor. PMID: 27009287 There is lack of association between C-344T polymorphism of CYP11B2 gene and Essential Hypertension in Dongxiang and Han populations from northwest of China , whereas the polymorphism was correlated in female population of Tibetan. PMID: 27149293 Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity. (Meta-analysis) PMID: 26556555 Gene polymorphism of CYP11B2 (-344C>T) may be associated with developing preeclampsia during pregnancy. PMID: 26686590 This meta-analysis is purposed to reveal the relationship between the -344C/T aldosterone synthase variant and the left ventricular structure and function. PMID: 25208931 Strong synergistic effect between ACE and CY11B2 gene polymorphisms in the molecular pathogenesis of Essential Hypertension in Kazakhs in Xinjiang was identified. PMID: 26305278 Adrenal tumors in patients with primary aldosteronism can demonstrate clear heterogeneity in cytochrome P450 family 11 subfamily B member 2 (CYP11B2) expression and somatic mutations in driver genes for aldosterone production PMID: 26765578 The study explores the relation between ACE D/I and CYP11B2 C-344T polymorphisms and parameters of arterial stiffness in the context of renal sodium handling. PMID: 26222001 univariate and multivariable analyses revealed no association between -344C/T of CYP11B2 and plasma glucose in patients with no diabetes, Homeostasis Model Assessment as an Index of Insulin Resistance, or left ventricular mass indexed to height. PMID: 26200036 suggested that the -344T>C polymorphism in Studies suggest that the cytochrome P450 11B2 (CYP11B2) gene might be associated with susceptibility to CAD in Caucasians and Asians. PMID: 25966076 The present meta-analysis supported the positive association of the CYP11B2 -344C/T variant with ischemic stroke. PMID: 23748625 Obesity risk increased with GRK4 A486V and CYP11B2 variants in Korean girls as sodium intake increased. PMID: 25768006 Our pooled data suggest a significant association exists between CYP11B2-344T>C polymorphism and atrial fibrillation among hypertension populations--{REVIEW} PMID: 25354523 findings characterize the haplotype-dependent regulation of the hCYP11B2 gene where -344T serves as a reporter polymorphism and show that Hap-I leads to increased expression of hCYP11B2, with permissive effects on blood pressure and inflammatory milieu. PMID: 25504670 This cataloguing of deleterious SNPs is essential for narrowing down the number of CYP11B2 mutations to be screened in genetic association studies and for a better understanding of the functional and structural aspects of the CYP11B2 protein. PMID: 25102047 polymorphism in the CYP11B2 gene was significantly associated with hypertension in the Chinese population PMID: 23204185 microRNA (miR)-766 binds to the 735G-allele and not the 735A-allele of the hCyp11B2 gene and may downregulate the expression of human aldosterone synthase gene and reduce blood pressure in human subjects containing -344T allele. PMID: 25351194 the CT and TT genotypes of aldosterone synthase C-344T polymorphism, frequency of alcohol consumption and aldosterone levels were significantly high among the total as well as male PMID: 25572238 Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension PMID: 25917967 CYP11B2 -344C/T polymorphism might be an independent risk factor of IgA nephropathy, focal segmental glomerulosclerosis and all proliferative chronic glomerulonephritis. PMID: 23681285 The objective of this study was to assess aldosterone polymorphisms and relationships to plasma aldosterone levels and the development of renal histological lesions in kidney transplant patients. PMID: 23257211 CYP11B2 polymorphism is an independent predictor for atrial fibrillation development in hypertrophic cardiomyopathy patients. PMID: 24599807 CYP11B2 genotype were associated to type 2 diabetes mellitus. PMID: 24549414 GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of aldosterone-producing adenoma. PMID: 24472523 Plasma aldosterone concentration is significantly associated with -344 C/T CYP11B2 polymorphism and with the treatment with spironolactone in resistant hypertensive subjects. PMID: 24388430 The 344 C/T polymorphism of the CYP11B2 gene predicts resolution of hypertension in patients undergoing adrnelactomy for aldosterone-producing adenoma. PMID: 22650983 tumor area in aldosterone-producing adenoma specimens was correlated with preoperative plasma aldosterone, urinary aldosterone excretion, and the H score of 11beta-hydroxylase and was inversely correlated with the H score of aldosterone synthase. PMID: 24842915 Aldosteronomas are hypomethylated, and CYP11B2 is overexpressed and hypomethylated in these tumors. PMID: 24423307 The C-344T aldosterone synthase gene variant is associated with preclinical vascular alterations in essential hypertension. PMID: 23490082 The present meta-analysis suggested that CYP11B2 C-344T polymorphism was unlikely contribute to ischemic stroke susceptibility. PMID: 23950878 -344C allele may be associated with decreased risk of Idiopathic hyperaldosteronism; there was still no enough evidence to indicate the association of A2718G polymorphism with Primay aldosteronism risk. PMID: 23535359 the CYP11B2 -344CC genotype was a significant and independent predictor of AF beyond conventional clinical and echocardiographic predictors of AF and genetic ancestry. It also associated with extreme elevation of serum aldosterone. PMID: 23936266

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.