Recombinant Human CYP11A1 Protein

Name: Recombinant Human CYP11A1 Protein
Brand: Beta LifeScience
SKU: BLA-13185P
Availability: InStock

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P05108
Synonym	Cholesterol 20 22 desmolase Cholesterol desmolase Cholesterol monooxygenase (side chain cleaving) Cholesterol side chain cleavage enzyme Cholesterol side chain cleavage enzyme mitochondrial Cholesterol side-chain cleavage enzyme CP11A_HUMAN CYP11A CYP11A1 CYPXIA1 Cytochrome P450 11A1 Cytochrome P450 11A1 mitochondrial Cytochrome P450 family 11 subfamily A polypeptide 1 Cytochrome P450 subfamily XIA Cytochrome P450(scc) Cytochrome P450C11A1 mitochondrial P450SCC Steroid 20 22 lyase
Description	Recombinant Human CYP11A1 Protein was expressed in Wheat germ. It is a Full length protein
Source	Wheat germ
AA Sequence	MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNE IPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVY VIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNL PPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVN DLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLI LMPEKPISFTFWPFNQEATQQ
Molecular Weight	87 kDa including tags
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	A cytochrome P450 monooxygenase that catalyzes the side-chain hydroxylation and cleavage of cholesterol to pregnenolone, the precursor of most steroid hormones. Catalyzes three sequential oxidation reactions of cholesterol, namely the hydroxylation at C22 followed with the hydroxylation at C20 to yield 20R,22R-hydroxycholesterol that is further cleaved between C20 and C22 to yield the C21-steroid pregnenolone and 4-methylpentanal. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin).
Subcellular Location	Mitochondrion inner membrane; Peripheral membrane protein.
Protein Families	Cytochrome P450 family
Database References	HGNC: 2590 OMIM: 118485 KEGG: hsa:1583 STRING: 9606.ENSP00000268053 UniGene: PMID: 28991453 The present study systematically evaluated the genetic effect of the estrogen metabolic pathway on alzheimer's based on 78 polymorphisms distributed across four genes. In the southern Chinese population, strong evidence of associations with AD were detected for polymorphisms in ESR2 and CYP11A1. PMID: 28102888 deregulation of miR-320a/RUNX2/CYP11A1 (CYP19A1) cascade plays an important role in the development of estrogen deficiency in human cumulus granulosa cells PMID: 27965096 The steroidogenic enzymes cytochrome P450 cholesterol side-chain cleavage enzyme (P450scc), cytochrome P450 17 alpha-hydroxylase (P450c17) and 3beta-hydroxysteroid dehydrogenase (3beta-HSD) showed immunoreactivity in 9/20 (45.0 %), 15/20 (75.0 %) and 13/20 (65.0 %), respectively, of ovarian-type stroma from pancreatic mucinous cystic neoplasm cases. PMID: 27060902 The findings of this study provided further support for the hypothesis that a susceptibility gene for autism spectrum disorder exists within or near the CYP11A1 gene in the Han Chinese population. PMID: 26690694 These findings contribute in clarifying the relationship between hormones regulating the early phase of steroidogenesis confirming that AMH is playing a suppressive role on CYP19A1 expression stimulated by gonadotropin in hGCs. Furthermore, a similar inhibitory effect for AMH was observed on P450scc gene expression when activated by gonadotropin treatment. PMID: 26631403 An epistatic effect between CYP11A1 and VDR polymorphisms may contribute to the predisposition to childhood asthma. PMID: 26750596 The study characterizes the intermediates in the second and third steps of the enzymatic process by which P450scc converts cholesterol to pregnenolone. PMID: 26603348 In prostate cancer, increased DNA methylation of SRD5A2 and CYP11A1 related to androgen biosynthesis functions may play a role in biochemical recurrence after patients' prostatectomy PMID: 26332453 polymorphisms of CYP11A1 are related to breast cancer susceptibility in Han Chinese women of South China. PMID: 22606018 Data indicate a role of cytochrome P450 11A1 (CYP11A1 in sterol metabolism. PMID: 25130438 CYP11A1 (tttta)(n) repeat polymorphism appeared to be a potential molecular marker for PCOS risk in our population. Gene-gene and gene-environmental interactions with respect to obesity may play a role in the early onset of this multifactorial condition. PMID: 24793009 There may be an association between CYP11A1 promoter pentanucleotide repeat polymorphism and polycystic ovary syndrome. (Meta-analysis) PMID: 24610422 This meta-analysis suggests that CYP11A1 microsatellite [TTTA]n repeat polymorphisms may contribute to increasing susceptibility to polycystic ovary syndrome among Caucasian populations. PMID: 23852617 the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower. PMID: 24244276 The results of this study demonistrated that Cyp11a1 is a target of SF-1 in gonadotroph cells and promotes proliferation/survival of rat pituitary adenoma primary cells and cell lines. PMID: 23756599 abnormally high expression of CYP11A inhibits trophoblastic proliferation and increases apoptosis and therefore could be involved in the pathogenesis of preeclampsia PMID: 23555723 study describes 7 patients with P450scc deficiency whose presentations ranged from severe neonatal adrenal crisis with wholly inactivating loss-of-function mutations in CYP11A1 to children who presented with normal male genitalia at up to 4 years of age PMID: 23337730 deficiencies in the steroidogenic acute regulatory protein and the cholesterol side chain cleavage enzyme cause neonatal adrenal failure PMID: 23158025 Tissues expressing P450scc can metabolize 7-dehydrocholesterol to biologically active 7-dehydropregnenolone. PMID: 22877869 Mutations in the CYP11A1 gene encoding cholesterol side-chain cleavage enzyme cause disordered pregnenolone synthesis, and STAR mutations do not necessarily results in typical congenital lipoid adrenal hyperplasia. PMID: 23330251 Carriers of the CYP11A1 TCG haplotype had lower (P PMID: 22673022 SNP rs4077582 in CYP11A1 is strongly associated with susceptibility to PCOS and may alter the testosterone levels by the regulation of LH in different genotypes. No association was observed in rs11632698. PMID: 22699877 NAD(+)-dependent SIRT deacetylase has a role in regulating the expression of mitochondrial steroidogenic P450 PMID: 22585829 Daxx, a HIPK kinase substrate in the apoptosis pathway, was phosphorylated by HIPK3 at Ser-669 in response to cAMP stimulation. PMID: 22199361 Features of the retinal environment which affect the activities and product profile of cholesterol-metabolizing cytochromes P450 CYP27A1 and CYP11A1. PMID: 22227097 Evidence that partial CYP11A1 deficiency has to be considered as a differential diagnosis in clinically isolated adrenal insufficiency. PMID: 21880796 Repeat polymorphism in CYP11A1 is associated with Prostate Cancer. PMID: 21771722 In PCOS patients, there was a correlation between UCP-2 and CYP11A1 expression, which was significantly higher than in the control group. PMID: 21557918 Results present the crystal structure of the complex of human adrenodoxin and CYP11A1--the first of a complex between a eukaryotic CYP and its redox partner. PMID: 21636783 We have identified regions of the promoter that control CYP11A1 expression in the brain and embryonic adrenals. PMID: 21520051 This article reviews recent studies on cis-regulatory elements and trans-regulators of the CYP11A1 promoter, with special focus on their tissue-specific regulation. PMID: 21195129 Partial loss-of-function CYP11A1 mutation can present with a hormonal phenotype indistinguishable from nonclassic lipoid lipoid adrenal hyperplasia PMID: 21159840 Polymorphism of CYP11A1 was associated with polycystic ovarian syndrome in Chinese patients. PMID: 20450755 P450 side-chain cleavage deficiency--a rare cause of congenital adrenal hyperplasia. PMID: 21164259 promoter variability of CYP11A1 does not play a key role in the pathogenesis of PCOS PMID: 21391350 No significant difference in P450(scc) mRNA was found among normal adrenal gland, APA or idiopathic hyperplastic nodules (P > 0.05). These results suggest that P450(scc) contributes little to the overproduction of aldosterone in APA and IHA. PMID: 20066577 Findings suggest that the syncytiotrophoblast cells are the major site expressing P450scc in early placenta, and that increasing P450scc in placental villi lay a foundation for site-shift of progesterone biosynthesis from the corpus luteum to placenta. PMID: 15323426 Genetic variants in CYP11A1 may influence endometrial cancer risk or may be markers for causal variants elsewhere. PMID: 20199803 Salt-inducible kinase represses cAMP-dependent protein kinase-mediated activation of cyp11a promoter through the CREB basic leucine zipper domain PMID: 11864972 p450scc expression is regulated by TReP-132, steroidogenic factor-1 and CBP/p300 PMID: 12101186 cholesterol is near-saturating for cytochrome P450scc activity in placental mitochondria due to the P450scc displaying a low K(m) for cholesterol resulting from the low and rate-limiting concentration of adrenodoxin reductase present PMID: 12137805 Transcription of cholesterol side-chain cleavage cytochrome P450 in the placenta: activating protein-2 assumes the role of steroidogenic factor-1 by binding to an overlapping promoter element. PMID: 12145340 Results support the hypothesis that NO inhibits the rate-limiting enzyme CYP11A1 in steroidogenesis independent of guanylyl cyclase activation. PMID: 12242026 cytochrome P450 side chain cleavage mRNA was increased threefold in the ovarian stroma of postmenopausal women with endometrial cancer and endometrial hyperplasia PMID: 12517592 TReP-132 interacts with steroidogenic factor-1 (SF-1) through specific domains; and along with the interaction with CBP/p300 these factors are postulated to form a complex to regulate expression of the P450scc gene. PMID: 12530663 CYP11A and CYP17 expressed centrally within fetal zone at 50 days post-conception and later during first trimester. Weaker CYP11A immunoreactivity also was visible in outer region of adrenal cortex consistent with definitive zone expresion. PMID: 12530676 CYP11A mRNAs were more abundant in polycystic ovary syndrome theca cells than in normal theca cells. PMID: 14644808 Associations between CYP11A promoter variation and androgen-related phenotypes has been substantially overestimated in previous studies. PMID: 15126571 CYP11A1 polymorphism near the promoter region may be an important susceptibility factor for breast cancer risk. PMID: 15159300

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human CYP11A1 Protein

Recombinant Human CYP11A1 Protein

Product Overview

Target Details

FAQs