Recombinant Human Cyclin-Dependent Kinases Regulatory Subunit 2 (CKS2) Protein (His&Myc)

Name: Recombinant Human Cyclin-Dependent Kinases Regulatory Subunit 2 (CKS2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-11027P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Cyclin-Dependent Kinases Regulatory Subunit 2 (CKS2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P33552
Target Symbol	CKS2
Synonyms	CDC28; CDC28 protein kinase 2; CDC28 protein kinase regulatory subunit 2; CKS 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog 2; Cks2; CKS2_HUMAN; CKSHS2; Cyclin dependent kinases regulatory subunit 2; Cyclin-dependent kinases regulatory subunit 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Expression Range	1-79aa
Protein Length	Full Length
Mol. Weight	17.3 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
Protein Families	CKS family
Database References	HGNC: 2000 OMIM: 116901 KEGG: hsa:1164 STRING: 9606.ENSP00000364976 UniGene: Hs.83758

Gene Functions References

that CKS2 play a role in tumor activation and serve as a useful potential target for the treatment of hepatocellular carcinoma PMID: 29487004
CKS2 is up-regulated in breast cancer and associated with large tumor size, lack expression of progesterone receptor, poor tumor differentiation and survival PMID: 25674223
CKS2 mRNA expression was higher in cancer tissue than in corresponding normal tissue. Patients with positive-CKS2 protein expression had a poorer five year survival frequency than patients who did not express CKS2 protein. PMID: 24604089
CKS2 mRNA and protein expression were increased in esophageal carcinoma. Overexpression of CKS2 was associated with higher grad, regional lymph node invasion, and neoplastic embolus. CKS2 was negatively associated with the p27(kip1) level in the tumor. PMID: 23301842
miR-26a and its target CKS2 modulate cell growth and tumorigenesis of papillary thyroid carcinoma. PMID: 23861775
Cks2 may serve as an independent prognostic factor in patients with cholangiocarcinoma, and play a role in the carcinogenesis of cholangiocarcinoma by facilitating cell cycle progression and Bax-mediated mitochondrial caspase-dependent apoptosis. PMID: 23121546
Study calculated DeltaCt values of CKS2 and LEPR and found that their differential expression (C-L index) was significantly higher in grade I than in grade II or III meningiomas. PMID: 21948653
The Cks2 gene may have potential as a biomarker for predicting superficial bladder cancer progression to muscle-invasive cancer. PMID: 21672358
CKS2 is one of the gastric cancer-related genes that correlates with biological aggressiveness and poor prognosis of gastric cancer. PMID: 21617860
the involvement CKS2 gene expression in bladder cancer tumorgenesis PMID: 20920335
p53, rather than its homologues p63 and p73, may contribute to control of the first metaphase/anaphase transition of mammalian meiosis by downregulation of Cks2 expression PMID: 17336302
Elevated expression of Cks1 may contribute to prostate tumorigenesis by promoting proliferation, anchorage-independent growth and migration of the cells, and elevated expression of Cks2 by protecting cells from undergoing programmed cell death. PMID: 18498131
Data show that cyclin-dependent kinase-associated proteins Cks1 and Cks2 are essential during early embryogenesis and for cell cycle progression in somatic cells. PMID: 18625720
Results suggest that the cell cycle regulator CKS2 might be deeply involved in gastric cancer progression. PMID: 19034516

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.