Recombinant Human Cyclin-Dependent Kinase Inhibitor 3 (CDKN3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10457P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cyclin-Dependent Kinase Inhibitor 3 (CDKN3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10457P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cyclin-Dependent Kinase Inhibitor 3 (CDKN3) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q16667 |
| Target Symbol | CDKN3 |
| Synonyms | CDI1; Cdk associated protein phosphatase; CDK2 associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; CDKN3; CDKN3_HUMAN; CIP2; Cyclin dependent kinase inhibitor 3; Cyclin dependent kinase interacting protein 2; Cyclin dependent kinase interactor 1; Cyclin-dependent kinase inhibitor 3; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; FLJ25787; KAP; KAP1; Kinase associated phosphatase; Kinase-associated phosphatase; MGC70625; OTTHUMP00000178991 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR |
| Expression Range | 1-212aa |
| Protein Length | Full Length |
| Mol. Weight | 25.8kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner. |
| Subcellular Location | Cytoplasm, perinuclear region. |
| Protein Families | Protein-tyrosine phosphatase family |
| Database References | HGNC: 1791 OMIM: 114550 KEGG: hsa:1033 STRING: 9606.ENSP00000335357 UniGene: PMID: 28109073 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
