Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor D (CDKN2D) Protein (GST)

Name: Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor D (CDKN2D) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09218P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor D (CDKN2D) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P55273
Target Symbol	CDKN2D
Synonyms	CDKN2DCyclin-dependent kinase 4 inhibitor D; p19-INK4d
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Expression Range	1-166aa
Protein Length	Full Length
Mol. Weight	44.7kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Interacts strongly with CDK4 and CDK6 and inhibits them.
Subcellular Location	Nucleus. Cytoplasm.
Protein Families	CDKN2 cyclin-dependent kinase inhibitor family
Database References	HGNC: 1790 OMIM: 600927 KEGG: hsa:1032 STRING: 9606.ENSP00000337056 UniGene: Hs.435051

Gene Functions References

p19(INK4d) plays an active role during human tooth development along with MSX1 and MSX2 PMID: 28933666
We unexpectedly found that p19INK4d plays an important role in human terminal erythropoiesis PMID: 27879259
p19(INK4D) is one of the key mediators of miR-125b activity during the onset of megakaryocyte polyploidization. PMID: 27763644
p19 may play an important role in the ototoxic effects of cisplatin and is probably involved in the pathogenesis of hearing loss. PMID: 26722409
MiR-451 inhibited the proliferation of esophageal squamous cell carcinoma cells by targeting CDKN2D and MAP3K1 expression. PMID: 26019450
Data indicate that upon oxidative DNA damage, cyclin-dependent kinase inhibitor p19INK4d strongly binds to and relaxes chromatin. PMID: 25204969
CDKN2D repression by PML/RARalpha disrupts both cell proliferation and differentiation in the pathogenesis of acute promyelocytic leukemia. PMID: 25275592
p19-INK4d inhibits neuroblastoma cell growth, induces differentiation and is hypermethylated and downregulated in MYCN-amplified neuroblastomas. PMID: 25104850
CDKN2D-WDFY2 fusion could be an important molecular signature for understanding and classifying sub-lineages among heterogeneous high-grade serous ovarian carcinomas. PMID: 24675677
Mutations in CDKN2D is associated with sporadic parathyroid adenoma. PMID: 24127162
P19(INK4d) expression is a poor prognostic factor in ovarian cancer patients. PMID: 24022213
PTB plays as a negative regulator in H1299 cell proliferation at least by inducing p19(Ink4d) expression at transcriptional and post-transcriptional levels. PMID: 23536791
Up-regulation of CDKN2D during in-vitro passages of human amniotic fluid-derived mesenchymal stromal cells may indicate the begging of early senescence process in a p53-independent mechanism. PMID: 22747700
E2F1 is involved in the induction of p19INK4d following UV irradiation PMID: 22476863
CDK2 and PKA mediated-sequential phosphorylation is critical for p19INK4d function in the DNA damage response to ensure cell survival. PMID: 22558186
expression of p19INK4D may be an effective predictor of clinical behavior in hepatocellular carcinoma, and therefore, a new prognostic marker PMID: 21901251
p19INK4d is transcriptionally regulated by E2F1 through two response elements present in the p19INK4d promoter. PMID: 21765927
protein folding and stability PMID: 11786024
The human p19(INK4d) gene is under the control of TATA-less promoter and the Sp1 binding site is involved in the transcription. PMID: 12062451
Deletions in the CDKN2D locus and hypermethylation in the CDKN2D promoter region plays a role in ovarian granulosa cell tumorogenesis. PMID: 12203782
p19(INK4d) in addition to p21(WAF1/Cip1) is an important molecular target of HDAC inhibitors inducing growth arrest PMID: 15107822
In addition to its role as cell cycle inhibitor, p19INK4d is involved in maintenance of DNA integrity and, therefore, would contribute to cancer prevention. PMID: 15750620
Data suggest that the graded stability and the facile unfolding of repeats 1 and 2 is a prerequisite for the down-regulation of the inhibitory activity of p19(INK4d) during the cell-cycle. PMID: 17804013
The study shows that mimicking the phosphorylation site of p19INK4d by a glutamate substitution at position 76 dramatically decreases the stability of the native but not an intermediate state. PMID: 19063602

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.