Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor B (CDKN2B) Protein (His&Myc)

Name: Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor B (CDKN2B) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-05007P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor B (CDKN2B) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P42772
Target Symbol	CDKN2B
Synonyms	CDK inhibitory protein; CDK4B Inhibitor; Cdkn2b; CDN2B_HUMAN; Cyclin dependent kinase 4 inhibitor B; Cyclin Dependent Kinase Inhibitor 2B; Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4; Cyclin dependent kinases 4 and 6 binding protein; Cyclin-dependent kinase 4 inhibitor B; INK4B; MTS 2; MTS-2; MTS2; Multiple tumor suppressor 2; Multiple Tumor Supressor 2; OTTHUMP00000021154; OTTHUMP00000021155; p14 CDK inhibitor; p14 INK4b; p14-INK4b; P15; p15 CDK inhibitor; p15 inhibits CDK4; p15 INK4b; p15-INK4b; p15INK4B; TP 15; TP15
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Expression Range	1-138aa
Protein Length	Full Length
Mol. Weight	19.7 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Subcellular Location	Cytoplasm. Note=Also found in the nucleus.
Protein Families	CDKN2 cyclin-dependent kinase inhibitor family
Database References	HGNC: 1788 OMIM: 600431 KEGG: hsa:1030 STRING: 9606.ENSP00000276925 UniGene: PMID: 29343775 CDKN2B expression in HPDE6-C7 human pancreatic ductal cells is induced by oncogenic KRAS via TGF-beta signaling. PMID: 28892048 findings suggest that the GG genotype of the CDKN2B-AS1 gene variant rs4977574, which has been previously associated with an increased CAD risk, is also associated with a decreased susceptibility to the development of hypertension PMID: 29791233 CDKN2B gene locus is a cardiovascular risk in ethnic Saudi Arabs PMID: 29894795 ANRIL plays an important role in the formation of atherosclerosis, and the artificial modification of ANRIL transcripts should be considered following the development of this disease. (Review) PMID: 29270737 CDKN2A/B locus SNPs may impact T2D risk by modulating islet gene expression and beta-cell proliferation. PMID: 29432124 Complete methylation and loss of p15 gene expression causes susceptibility to relapse and decreased survival in APL patients. Thus, p15 promoter hypermethylation is a prospective prognostic indicator and a reliable clinical aid in assessment of patients with APL. PMID: 28052659 Patients with higher levels of DNA methylation of CDKN2B may bear increased risk for aortic arch calcification PMID: 27773886 E2F1 induces TINCR transcriptional activity and accelerates gastric cancer progression via activation of TINCR/STAU1/CDKN2B signaling axis. PMID: 28569791 ANRIL may reduce p15INK4B expression through inhibiting TGF-beta/Smad signaling pathway, promoting invasion and metastasis of TC cells, and the silencing of ANRIL inhibits the invasion and metastasis of TPC-1 cells PMID: 27507052 The obtained data suggested a negative association between copy number variation of the CDK2B genes and Atherothrombotic stroke. PMID: 28477716 Among 8 SNPs in 3 loci that showed at least nominal association (P < 5.00E-02) in the primary cohort, a representative SNP for each loci (rs2157719 for CDKN2B-AS1, rs33912345 for SIX6, and rs9913911 for GAS7) were selected PMID: 29261660 Results show that expression of CDKN2B was reduced significantly in colorectal cancer (CRC) and its promotor is targeted by miR-18b which controls its regulation. PMID: 28784723 Mechanistic investigations demonstrated that BLACAT1 had a key role in G1/G0 arrest, and showed that BLACAT1 can repress p15 expression by binding to EZH2, thus contributing to the regulation of CRC cell cycle and proliferation. Our results suggest that BLACAT1, as a cell cycle regulator, may serve as a potential target for colon cancer prevention and treatment in human CRC PMID: 28277544 DNA methylation of CDKN2B may play a potential role in artery calcification. PMID: 27905995 These data support the hypothesis that decreased p15 expression is a robust biomarker for distinguishing nevus from melanoma. PMID: 27855847 Total 1208 differentially expressed genes were screened, and 5 coronary artery disease (CAD)-associated miRNAs (including miR-92a) were predicted associated with CAD. The SVM classifier was constructed based on the 41 featured genes and had high recognition efficiency. Only one lncRNA CDKN2B-antisense targeting miR-92a was obtained. PMID: 28760552 Upregulation of ZEB1-AS1 colorectal cancer promotes cell proliferation and inhibits cell apoptosis. In addition, cell cycle inhibitory protein p15 participates in the oncogenic function of ZEB1-AS1. Collectively, ZEB1-AS1 has asignificant effect on colorectal cancer pathological process and serves as a valuable prognostic biomarker for colorectal cancer. PMID: 28618933 Genetic association analyses using the cpRNFLT with 768 points suggest that the CDKN2B gene was associated with paracentral/lower hemifield scotomas. PMID: 28472212 We found that CDKN2B was a virtual target of miR-15a-5p with potential binding sites in the 3'UTR of CDKN2B (77-83 bp). We also showed that miR-15a-5p could bind to the CDKN2B 3'UTR. The data revealed a negative regulatory role of miR-15a-5p in the apoptosis of smooth muscle cells via targeting CDKN2B, and showed that miR-15a-5p could be a novel therapeutic target of AAA. PMID: 28214350 Meta-analysis indicates that CDKN2B gene rs1063192 polymorphism is significantly associated with a decreased risk of glaucoma. [meta-analysis] PMID: 28416752 results suggest that the cyclin dependent kinase inhibitor 2B rs10811656 locus might be associated with coronary artery disease in a Chinese Han population PMID: 27507036 Polymorphism rs1063192 in CDKN2B is not a risk factor for Open-Angle Glaucoma in Saudi cohort. PMID: 27541204 The CC genotype of CDKN2B rs1063192 in the hsa-miR-323b-5p binding site increased the risk of gestational diabetes mellitus in pregnant Chinese Han women PMID: 25990668 Genetic risk variants in the CDKN2B gene is associated with somatic biomarkers in glioma. PMID: 26839018 Aberrant methylation of the promoter regions of the p15INK4b gene in patients with acute myeloid leukemias. PMID: 27459612 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine. PMID: 26782424 Tumor suppressor ASXL1 is essential for the activation of INK4B expression in response to oncogene activity and anti-proliferative signals PMID: 26470845 This study investigated the potential roles of CDKN2B-related piRNA in leukemia cells to provide a potential tumorigenesis model of leukemia PMID: 26205624 CDKN2B Loss Promotes Progression from Benign Melanocytic Nevus to Melanoma PMID: 26183406 Children with ALL have higher levels of p15 CpG island methylation than a control group of children with ITP. PMID: 26501552 High expression of p15 antisense RNA is associated with acute myeloid leukemia. PMID: 27060304 CDKN2B variants are associated with pediatric B-cell precursor acute lymphoblastic leukemia. PMID: 26868379 Loss of CDKN2B may not only promote cardiovascular disease through the development of atherosclerosis but may also impair TGFbeta signaling and hypoxic neovessel maturation. PMID: 26596284 CD93 regulates LSC self-renewal by silencing CDKN2B in MLL leukemia PMID: 26387756 The treatment of Raji cell line with 10 muM curcumin caused hypomethylation of the p15 promoter after six days. This led to the up-regulation of p15 and down-regulation of DNA methyltransferase 1. PMID: 26333125 Findings identify germline CDKN2B mutations as a novel cause of familial renal cell carcinoma. PMID: 25873077 There was no association between germline coding CDKN2B variants and B cell acute lymphoblastic leukemia in children. PMID: 26104880 Results show that ANRIL positively regulates the proliferation of cancer cells, via regulating p15 and other genes related to G2/M phase control. PMID: 26408699 these data show that DC-SCRIPT acts as a novel regulator of CDKN2B and induces cell cycle arrest in ESR1-positive breast cancer cells. PMID: 25663546 silencing of p15 gene expression by epigenetic modification such as promoter hypermethylation plays a role not only in the initiation of multiple myeloma but also in plasma cell malignant transformation, disease progression, and development PMID: 25382971 promoter methylation of p15 gene could have prognostic value in diffuse large B-cell lymphoma patients. PMID: 24815848 CDKN2B locus deletion is associated with melanoma brain metastases. PMID: 24968695 genotypes of the polymorphic markers of KCNJ11, SLC30A8 and CDKN2B genes showed the presence of association with T2DM in Russian population, while for the FTO gene was not found statistically significant associations with type 2 diabetes PMID: 25916116 CDKN2B polymorphism is associated with the development of coronary atherosclerosis. PMID: 24573017 Single nucleotide polymorphisms in CDKN2B gene are associated with cancer. PMID: 25239644 Exogenous p15 protein expression combined with STI571 appeared to have a synergistic effect on proliferation inhibition and apoptosis induction in K562 cells. PMID: 24938701 Investigate the relationship between urinary nickel and methylation of p16 in workers exposed to nickel. The levels of urinary nickel were significantly associated with the methylation of p15. PMID: 24806561 CDKN2B upregulation was found in myelodysplastic syndrome mesenchymal stem cells. PMID: 24943834 Loss of p15INK4b was associated with older age. PMID: 24716938

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.