Recombinant Human Cyclin-Dependent Kinase 2-Interacting Protein (CINP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10141P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cyclin-Dependent Kinase 2-Interacting Protein (CINP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10141P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Cyclin-Dependent Kinase 2-Interacting Protein (CINP) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9BW66 |
Target Symbol | CINP |
Synonyms | CDK2-interacting protein; CINP; CINP protein; CINP_HUMAN; Cyclin dependent kinase 2 interacting protein; Cyclin-dependent kinase 2-interacting protein; MGC849 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL |
Expression Range | 1-212aa |
Protein Length | Full Length |
Mol. Weight | 40.3kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling. |
Subcellular Location | Nucleus. Note=Binds to nuclear under G1 conditions, and dissociates from chromatin with the start of DNA replication. |
Protein Families | CINP family |
Database References | HGNC: 23789 OMIM: 613362 KEGG: hsa:51550 STRING: 9606.ENSP00000442057 UniGene: PMID: 21628470 |