Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) Protein (GST)

Name: Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10074P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O14519
Target Symbol	CDK2AP1
Synonyms	CDK2 A1; CDK2 associated protein 1; CDK2-associated protein 1; CDK2AP1; CDKA1; CDKA1_HUMAN; Cyclin dependent kinase 2 associated protein 1; Cyclin-dependent kinase 2-associated protein 1; Deleted in oral cancer 1; DOC 1; DOC 1 related protein; DOC 1R; DOC-1; DOC1; DOC1R; DORC1; p12DOC 1; Putative oral cancer suppressor; ST19
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Expression Range	1-115aa
Protein Length	Full Length
Mol. Weight	39.4kDa
Research Area	Cell Cycle
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	specific inhibitor of the cell-cycle kinase CDK2.
Protein Families	CDK2AP family
Database References	HGNC: 14002 OMIM: 602198 KEGG: hsa:8099 STRING: 9606.ENSP00000261692 UniGene: Hs.433201

Gene Functions References

A compelling relationship exists between high CDK2AP1 mRNA expression and lower TNM classification of breast cancer, which is consistent with CDK2AP1 having a tumour-suppressive function. PMID: 30343278
Knockdown of CDK2AP1 in hESCs results in increased p53 and enhances differentiation and favors it over a self-renewal fate. PMID: 29734353
DOC1 re-expression in oral cancer cells causes a reversal of EMT. DOC1 promotes NURD binding to a subset of target loci. PMID: 28683324
The simultaneous overexpression of p12CDK2-AP1 and CD82 significantly suppressed the in vivo tumor growth. PMID: 27349208
knockdown of CDK2AP1 in primary human fibroblasts reduced proliferation and induced premature senescence, with the observed phenotype being p53 dependent PMID: 25785833
In summary, p12CDK2AP1 expression in myxofibrosarcoma cells induces G0/G1 arrest and mitochondria dependent proapoptotic activity and down-regulation of p12CDK2AP1 by shRNAi results in up-regulation of the CDK2 transcript and protein. PMID: 24889487
Study reports that knockdown of CDK2AP1 by RNAi in glioma cells could effectively inhibit cell proliferation by inducing cell cycle arrest and apoptosis PMID: 24620959
CDK2AP1 plays an important role in modulating the growth and tumorigenesis of lung cancer cells. PMID: 23404055
Low CDK2AP1 expression is common and associated with adverse prognosis in nasopharyngeal carcinoma. PMID: 22791769
Human cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) is dimeric in its disulfide-reduced state, with natively disordered N-terminal region PMID: 22427660
exerts its effect on stem cell maintenance/differentiation through epigenetic regulation [review] PMID: 21865592
In comparison with the healthy gingiva, the expression of Doc-1 was decreased, whereas the expression of S100A7 was upregulated in all oral lesions. PMID: 21740085
P12(CDK2AP1) is downregulated by miR-21 PMID: 21328460
Missing down-regulation of the tumor-suppressor gene DOC-1, might exert protective effects and counteract malignant transformation of benign, proliferating lesions of the oral cavity. PMID: 21187770
Data support the role of cdk2ap1 as a tumor suppressor gene that can regulate squamous cell carcinoma growth in a cell autonomous manner through decreases in invasiveness and a non-cell autonomous manner through decreases in angiogenesis phenotypes. PMID: 20541561
The combination of an increased expression of the antimicrobial peptide DEFA-4, the oncogene S100-A7, epidermal growth factor, and tenascin-c, and a decreased Doc-1 expression in oral leukoplakia might characterize its potency of malignant transformation. PMID: 20727496
Results indicate that DOC-1 is a bona fide subunit of the Mi-2/NuRD chromatin remodeling complex. PMID: 20523938
CDK2AP1 is a novel multiple sclerosis susceptibility loci, and it's risk allele correlates with diminished RNA expression of the cell cycle regulator CDK2AP1 PMID: 20555355
Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4. PMID: 19679565
DOC1 has a differential expression in microsatellite-unstable human colorectal neoplasms. PMID: 13679870
plays a role in TGF-beta1-mediated growth suppression by modulating CDK2 activities and pRB phosphorylation PMID: 14744761
p12CDK2-AP1 forms nuclear homodimers in contact inhibited normal diploid cells and dimerization of p12 is a necessary process for the growth inhibition effect by p12 PMID: 15840587
Resistance to TGF-beta 1-induced growth suppression is due to the disruption of its signaling pathway as a consequence of reduced or lost p12(CDK2-AP1). PMID: 17217620
the del T poly (T) 8 observed in the 3'-UTR of the CDK2-AP1 gene in human microsatellite unstable colorectal cancer is functionally significant and results in decreased CDK2-AP1 expression PMID: 17689689
expression negatively associated with a more advanced depth of tumor invasion and stage in gastric carcinoma PMID: 19279387
p12CDK2-AP1 is associated with tumor progression and a poor prognosis in esophageal squamous cell carcinoma. PMID: 19513502
The expression of cdk2ap1 correlated with a reduction in cellular growth, irrespective of inhibition or stimulation of androgen receptor (AR) signaling pathways PMID: 19585490

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.