Recombinant Human Cyclin-A1 Isoform 2 (CCNA1) Protein (His)

Name: Recombinant Human Cyclin-A1 Isoform 2 (CCNA1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09393P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cyclin-A1 Isoform 2 (CCNA1) Protein (His) is produced by our Baculovirus expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P78396
Target Symbol	CCNA1
Synonyms	CCN A1; CCNA 1; Ccna1; CCNA1_HUMAN; Cyclin-A1; CyclinA1; G2/mitotic specific cyclin A1; MGC132235; MGC159139
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-6His
Target Protein Sequence	METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLL
Expression Range	1-464aa
Protein Length	Extracellular Domain
Mol. Weight	54.2kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.
Subcellular Location	Nucleus.
Protein Families	Cyclin family, Cyclin AB subfamily
Database References	HGNC: 1577 OMIM: 604036 KEGG: hsa:8900 STRING: 9606.ENSP00000255465 UniGene: PMID: 29154753 Cyclin A1 functions as an oncogene that controls proliferative and survival activities in tumourigenesis and chemoresistance of ovarian cancer. PMID: 27669502 In the bone marrow, cyclin A1 and aromatase enhanced local bone marrow-releasing factors, including androgen receptor, estrogen and matrix metalloproteinase MMP9 and promoted the metastatic growth of prostate cancer cells PMID: 26921336 The data showed that E7 induced CCNA1 methylation by forming a complex with Dnmt1 at the CCNA1 promoter, resulting in the subsequent reduction of expression in cancers. PMID: 26250467 DNA methylation status of key cell-cycle regulators such as CDKNA2/p16 and CCNA1 correlates with treatment response to doxorubicin and 5-fluorouracil in locally advanced breast tumors. PMID: 25294903 These data from results indicated a significant connection of CCNA1 methylation with poor progression in human malignant tumors among both Caucasian and Asian populations. PMID: 25654082 Cyclin A1 immunoexpression is of potential utility in predicting disease progression in patients with pT1 urothelial carcinomas of the bladder PMID: 25039670 HS3ST2 and CCNA1 genes may play important roles in HPV-induced cervical cancer and patients with specific hypermethylated genes may have a greater risk of progressing to invasive cervical cancer. PMID: 25198553 CCNA1 promoter methylation is associated with cervical squamous intraepithelial lesions. PMID: 25292097 High CCNA1 expression is associated with nasopharyngeal carcinoma. PMID: 25265349 Mutations in genes such as AKT2, CCNA1, MAP3K4, and TGFBR1, were associated significantly with Epstein-Barr-positive gastric tumors, compared with EBV-negative tumors. PMID: 25173755 Promoter reporter assays with a series of deletion constructs determined that the DNA element from -102 to -96 bp of the cyclin A1 promoter is responsible for PITX2-induced gene expression. PMID: 24002705 presents CCNA1 and TIMP3 hypermethylation as a helpful tool to identify HNSCC subjects at risk of developing second primary carcinomas PMID: 24359512 Overexpression of cyclin A1 in FSHD indicates cell cycle dysregulation in FSHD and might contribute to clinical symptoms of this disease PMID: 24019929 Nuclear FoxO3a promotes cell cycle progression by transcriptional upregulation of cyclin A1, promoting proliferation of human anaplastic thyroid carcinoma cells. PMID: 22718346 These findings indicate the possible involvement of cyclins A and E in the pathogenesis of malignant melanoma. PMID: 22763964 The organization of actin and cytokeratin cytoskeleton and the expression of TCTP, p53,cyclin A, RhoA and actin in HIO180 non-transformed ovarian epithelial cells, and OVCAR3 and SKOV3 ovarian epithelial cancer cells, was studied. PMID: 23042265 Cyclin A1 as overexpressed in induced lpuripotent stem cells cells compared to embryonic stem cells, suggesting that during reprogramming, cyclin A1 protein expression levels are not set correctly. PMID: 22500553 Cyclin A1 is an important cell cycle regulator with age-related increased expression in tonsils of children. HPV16 induces overexpression of Cyclin A1 in HNSCC despite promoter methylation. PMID: 22712549 Increased cyclin A1 in human bladder cancer cells may be regulated by activity of the USP2a deubiquitinase. PMID: 22370483 Cyclin-A1 is the first prototypic leukemia-testis-antigen to be expressed in acute myeloid leukemia leukemic stem cells. PMID: 22529286 Oxidized low density lipoprotein induces cyclin A synthesis in a process involving ERK, JNK and NFkappaB PMID: 21764057 The integrated form of HPV might lead to CCNA1 promoter methylation in cervical cancer by some mechanisms. PMID: 21412159 CCNA1 methylation may play a crucial role in HPV16-induced carcinogenesis of HNSCC independently of p53 PMID: 21563216 anti-oncogenic role of miR-372 may be through control of cell growth and cell cycle progression by down-regulating the cell cycle genes CDK2 and cyclin A1 PMID: 21646351 mRNA expression of cyclin A1 in myelodysplastic syndrome patients is higher than in normal controls. PMID: 19379570 An increase in cyclin A1 expression was the only differentially expressed cell cycle regulatory gene found. Greater cyclin A protein levels were consistently observed in cells with active IRE1alpha and were dependent on XBP-1. PMID: 20013084 revealed that KDM8 occupies the coding region of cyclin A1 and directly regulates transcription. PMID: 20457893 These results indicate that HIV-1 integrase is required during uncoating for maintaining CypA-capsid protein interaction, which promotes optimal stability of the viral core. PMID: 20219923 Methylation of CCNA1 in cervical scrapings is strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer. PMID: 19843677 Four point mutations, c.321T>C, IVS3 +32G>C, IVS5+38A>G and c.1158G>A, are not associated with spermatogenesis impairment. PMID: 19886767 the level of cyclin A1 mRNA expression predicts meiotic disorders during spermatogenesis PMID: 12121569 CCNA1 had successive increases in its promoter activity during spermatgogensis in transgenic mice. PMID: 12579332 study provides evidence that the cyclin A1-cyclin dependent kinase 2 complex plays a role in several signaling pathways important for cell cycle control and meiosis PMID: 15159402 Cyclin A1 methylation was inversely related to p53 mutational status in primary tumors, and forced expression of cyclin A1 resulted in robust induction of wild-type p53 in HNSCC cell lines. PMID: 15342377 These findings establish a novel function for cyclin A1 and CDK2 in DNA double strand break repair following radiation damage. PMID: 15456866 these analyses demonstrate that cyclin A1 contributes to G1 to S cell cycle progression in somatic cells. PMID: 15829981 cyclin A1 mediates VEGF expression in cooperation with Rb- and androgen-dependent pathways in prostate cancer PMID: 16007189 Significant tumour specific methylation of cyclin A1 promoter seen in oral sqmaous cell carcinoma PMID: 16449996 The data implicate cyclin A1 as a downstream player in p53-dependent apoptosis and G2 arrest. PMID: 16799873 Mip/LIN-9 is required for the expression of B-Myb, and both proteins collaborate in the control of the cell cycle progression via the regulation of S phase and cyclin A, cyclin B, and CDK1 PMID: 17098733 these analyses demonstrate that cyclin A1 exerts antiapoptotic functions by interacting with retinoblastoma and Ku proteins in leukemia cells. PMID: 17455244 Over expression of H179Y-mutant p53 promoted G1 to S phase transition with enlarged cell size and increased cyclin A1 and Cdk4 expression in HELF cells. PMID: 17530187 G2 phase cyclin A/cdk2 controls the timing of entry into mitosis by controlling the subsequent activation of cyclin B/cdk1, but also has an unexpected role in coordinating the activation of cyclin B/cdk1 at the centrosome and in the nucleus PMID: 18372919 Cyclin A1 contributes to prostate cancer invasion by modulating the expression of MMPs and VEGF and by interacting with AR (androgen receptor). PMID: 18612129 The CCNA1, CCNB1, CCNB2, PRM1, and PRM2 messenger RNA transcript ratios were significantly decreased in patients with spermatogenic disorders. Transcript ratios in patients with successful sperm retrieval were higher than with failed sperm retrieval. PMID: 18692784 Results suggest that cyclin A1 protein is stabilized via post-transcriptional modification in response to apoptosis induced by staurosporine or TNFalpha. PMID: 18787932 Cyclin A1- and cyclin A2-containing CDK complexes were compared in vitro by determining kinetic constants and by examining the complexes for their ability to phosphorylate pRb and p53. PMID: 19056339 Study shows that transcription corepressor CtBP2 directly binds acinus, which is regulated by nerve growth factor (NGF), inhibiting its stimulatory effect on cyclin A1, but not cyclin A2, expression in leukemia. PMID: 19668232

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Cyclin-A1 Isoform 2 (CCNA1) Protein (His)

Recombinant Human Cyclin-A1 Isoform 2 (CCNA1) Protein (His)

Product Overview

Target Details

FAQs