Recombinant Human Creatine Kinase M-Type (CKM) Protein (GST)

Name: Recombinant Human Creatine Kinase M-Type (CKM) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-06267P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Creatine Kinase M-Type (CKM) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P06732
Target Symbol	CKM
Synonyms	(Creatine kinase M chain)(Creatine phosphokinase M-type)(CPK-M)(M-CK)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Expression Range	1-381aa
Protein Length	Full Length
Mol. Weight	70.6 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Subcellular Location	Cytoplasm.
Protein Families	ATP:guanido phosphotransferase family
Database References	HGNC: 1994 OMIM: 123310 KEGG: hsa:1158 STRING: 9606.ENSP00000221476 UniGene: PMID: 28916380 Low CK-MB expression is associated with ST-Segment Elevation Myocardial Infarction. PMID: 28100880 On admission, high-sensitivity troponin T/creatine kinase-MB ratio was significantly higher in takotsubo syndrome patients compared to myocardial infarction patients. PMID: 28595746 A genetic factor known to be associated with constitutive creatine kinase levels is also associated with creatine kinase variability and inducibility and the variant has an impact on inducibility of creatine kinase by trauma through a homozygous carrier. PMID: 28790154 Marathoners with a lower CKMM response after the race had a more favorable polygenic profile than runners with high serum CKMM concentrations. This might suggest a significant role of genetic polymorphisms in the levels of exertional muscle damage and rhabdomyolysis. PMID: 28257486 Myocardial Creatine Kinase is a significant independent predictor of 6-month left ventricle remodeling in myocardial infarction patients. PMID: 28138312 A positive association was found between PANSS-total and sCK [serum creatine kinase] in SzA [schizoaffective disorder] and BP-I; however, PANSS-positive scores correlated with sCK only in SzA. Serum CK may serve as a biomarker for affective exacerbation rather than psychosis. PMID: 27086253 These results demonstrate an association between physical performance measures and genetic variation in the muscle-specific creatine kinase gene (rs8111989). PMID: 26327553 Muscle pain induced by simvastatin resulted in increased levels of creatine kinase compared to non-treated patients. PMID: 26874453 Data show that a low serum creatine kinase activity is more common in female than male, and is associated with older age. PMID: 26738403 CK-MB mass is more significant criteria of myocardial injury. PMID: 25802449 troponin T and creatinine kinase isoenzyme (CK-MB) have roles in combined renal and myocardial injuries in asphyxiated infants PMID: 24625749 The serum expression levels of myocardial creatine kinase and of galectin-3 reflect the physiopathology state of children with congenital heart defects after surgical correction. PMID: 26118042 The variant rs11559024 in the CKM gene (Glu83Gly) was significantly associated with CK levels of statin users. PMID: 25214527 elderly women classified as high response experienced greater serum response to eccentric resistance exercise PMID: 24189370 Based on the obtained results, it may be speculated that the CKM A/G polymorphism is not an important determinant of endurance performance level in Polish and Russian rowers. PMID: 26027379 Substantive creatine phosphokinase increases and rhabdomyolysis with statin use were particularly seen in patients starting treatment, those on large daily doses or interacting drugs or with larger numbers of concomitant drugs PMID: 24602118 serum CK-MB elevated in underweight hemodialysis patients PMID: 24846126 Asymptomatic hyper-CKemia is an uncommon association with hyponatremia of various etiologies. PMID: 24673369 Cardiac enzyme elevations post-cardiac bypass or post-percutaneous coronary intervention are associated with an adverse long-term mortality; the causes of which are multifactorial. PMID: 23993326 3D mapping of the CK reaction rates and metabolic fluxes can be achieved in the skeletal muscle in vivo at relatively high spatial resolution and with acquisition times well tolerated by patients. PMID: 23436474 High levels of blood creatine-kinase MB are associated with embolism source during acute phase of ischemic stroke. PMID: 22592287 This study explored the relationship of cardiac function examined by echocardiography and serum creatine kinase (CK) and CK-MB levels with myocardial ischemia-reperfusion injury in a cohort of Chinese acute myocardial infarction patients. PMID: 21873942 The crystal structure of CK indicates that the E79 and K138 interaction plays key roles in sustaining the recognition between N-terminal and C-terminal domains of muscle creatine kinase. PMID: 23274523 The current enzymatic definition of procedural myocardial infarct (MI) (CK-myocardial band more than 3 times the upper limit of normal) used in clinical trials is less strongly associated with death than that of spontaneous MI. PMID: 23122801 Creatine kinase MM TaqI and methylenetetrahydrofolate reductase C677T and A1298C gene polymorphisms influence exercise-induced C-reactive protein levels. PMID: 21706313 Results indicate that these polymorphisms can indirectly influence performance, contribute to higher susceptibility to exercise-induced inflammation or protection against it, and perhaps affect future risks of CVD in athletes. PMID: 21516340 Common variants of MSTN and CKM genes don't play a role in attaining high level endurance performance in Caucasians. PMID: 20536908 Elevated creatine kinase-MB is associated with elevated white blood cell count and atherosclerotic plaque in patients with elective stent implantation. PMID: 20591515 Cardiac troponin T and creatine kinase have roles in infarct size and left ventricular function after acute myocardial infarction PMID: 21448949 Muscle-type creatine kinase physically interacts with the slow skeletal muscle-type MyBPC1 (myosin-binding protein C1). PMID: 21426302 The overall efficacy of IMA [ischemia modified albumin]in differentiating AMI[Acute Myocardial Infarction] from Non-AMI cases appears to be comparable to that of CK-MB and cTnI PMID: 21456469 two residues close to the dimer interface of MMCK were crucial for species-specific thermal stability PMID: 20558199 The researchers found no association between the CK response after exercise and the presence of the CK-MM NcoI polymorphism. PMID: 20157874 percutaneous coronary intervention induces temporal changes of P-selectin, Mg, and CK-MB, which may be involved in restenosis and ischemia-reperfusion injury, but not PAI-1 PMID: 20669347 Elevated CK-MB values after elective angioplasty predicts reduced long-term event-free survival. PMID: 19670037 The Dimension Vista cTnI, CK-MB, MYO, NTproBNP, and hsCRP methods demonstrate acceptable performance characteristics for use as an aid in the diagnosis and risk assessment of patients presenting with suspected acute coronary syndromes. PMID: 19523464 A short version of the muscle creatine kinase promoter(MCK1350) allows for sustained dystrophin expression in skeletal muscle of newborn mdx mice. PMID: 11922612 Results identify muscle-type creatine kinase as a binding partner of a central portion of myomesin and the closely related M-protein. PMID: 12972258 The roles of Ile-69 and Val-325 are discussed in the delivery of both substrate specificity and catalysis of human muscle creatine kinase isozyme. PMID: 15504039 In top-level professional cyclists capable of completing a classic 3-wk tour race, the frequency distribution of the D allele and the DD genotype seems to be higher than in other endurance athletes such as elite runners. PMID: 16037885 Creatinine kinase-MB levels are elevated after adverse outcomes following percutaneous coronary interventions PMID: 16087811 Elevated levels of creatinine kinase-MB after percutaneous coronary intervention are not a predictor of adverse outcomes PMID: 16092153 first monomeric intermediate captured during refolding of muscle-type creatine kinase; authors propose that aggregation is caused by interaction between such monomeric intermediates. PMID: 16373479 CK-MM autoantibodies can modulate the rate of CK clearance from the circulation in myositis PMID: 16810680 The results show conclusively that, Cys283 is not responsible for the pKa of 5.4 observed in the WT V/K(creatine) pH profile. PMID: 16981706 generation of O-CK is a negative regulation of R-CK and O-CK might play essential roles in the molecular turnover of MM-CK PMID: 17303563 CK-MM AA genotype and percent body fat may be part of the constellation of mechanisms that explain susceptibility to exertional rhabdomyolysis. PMID: 17478608 Indicate a positive association of the ACE ID genotype with creatine kinase response to strenuous exercise. Genotype may determine risk for developing muscle damage. PMID: 17885020 Muscle type CK elevation in hypertrabeculation/noncompaction suggests neuromuscular disorder and prompts neurological investigations. PMID: 18055044

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.