Recombinant Human Contactin-Associated Protein 1 (CNTNAP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09807P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Contactin-Associated Protein 1 (CNTNAP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09807P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Contactin-Associated Protein 1 (CNTNAP1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P78357 |
| Target Symbol | CNTNAP1 |
| Synonyms | Caspr; Caspr1; CNTNAP; Cntnap1; CNTP1_HUMAN; Contactin associated protein 1; Contactin-associated protein 1; MHDNIV; NCP1; Neurexin 4; Neurexin IV; Neurexin-4; Nrxn4; p190; Paranodin |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTEMFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCL |
| Expression Range | 26-356aa |
| Protein Length | Partial |
| Mol. Weight | 53.8kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Required, with CNTNAP2, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the paranodal region of the axo-glial junction. In association with contactin involved in the signaling between axons and myelinating glial cells. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. Cell junction, paranodal septate junction. |
| Protein Families | Neurexin family |
| Database References | HGNC: 8011 OMIM: 602346 KEGG: hsa:8506 STRING: 9606.ENSP00000264638 UniGene: PMID: 29895952 |
