Recombinant Human Complement Receptor Type 1 (CR1) Protein (GST)

Name: Recombinant Human Complement Receptor Type 1 (CR1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-04021P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Complement Receptor Type 1 (CR1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P17927
Target Symbol	CR1
Synonyms	C3 binding protein; C3b/C4b receptor; C3BR; C4BR; CD 35; CD35; CD35 antigen; complement component (3b/4b) receptor 1 (Knops blood group); complement component (3b/4b) receptor 1 including Knops blood group system; Complement component receptor 1; Complement receptor 1; Complement receptor type 1; CR 1; CR1; CR1_HUMAN; KN; Knops blood group antigen
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Expression Range	41-234aa
Protein Length	Partial
Mol. Weight	48.4kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Membrane immune adherence receptor that plays a critical role in the capture and clearance of complement-opsonized pathogens by erythrocytes and monocytes/macrophages. Mediates the binding by these cells of particles and immune complexes that have activated complement to eliminate them from the circulation. Acts also in the inhibition of spontaneous complement activation by impairing the formation and function of the alternative and classical pathway C3/C5 convertases, and by serving as a cofactor for the cleavage by factor I of C3b to iC3b, C3c and C3d,g, and of C4b to C4c and C4d. Plays also a role in immune regulation by contributing, upon ligand binding, to the generation of regulatory T cells from activated helper T cells.; (Microbial infection) Acts as a receptor for Epstein-Barr virus.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Receptors of complement activation (RCA) family
Database References	HGNC: 2334 OMIM: 120620 KEGG: hsa:1378 STRING: 9606.ENSP00000356016 UniGene: PMID: 30044434 CR1 rs1704660G, rs17047661G and rs6691117G variants were significantly associated with Chagas disease. PMID: 29323238 Meta-analysis validated the association of late onset Alzheimer disease with CR1 (rs6656401) variants. PMID: 29504051 rs6656401 CR1 is not associated with late-onset Alzheimer's disease. PMID: 28477215 CR1 plays a vital role in Alzheimer's disease pathology and disease progression. PMID: 26742530 the effect of CR1 rs3818361 polymorphism on Alzheimer's disease (AD) risk in Chinese cohorts is consistent with the increased risk observed in European AD cohorts. PMID: 26189835 Genetic variation within the CR1 gene is associated with inflammation and the risk of incident coronary artery disease. PMID: 28033544 The distribution of the CR1 alleles, genotypes and haplotypes differed significantly among population in Brazil, Vietnam, India, Republic of Congo and Ghana. PMID: 28520715 CD16 and CD35 are important for neutrophil internalization of M. tuberculosis, whereas HIV-1 infection adversely affects opsonophagocytosis. PMID: 27258232 This study demonstrates an up-regulation of complement regulatory proteins, CD35 and CD55 in HIV associated pre-eclamptic compared to normotensive pregnancy. PMID: 27521598 Although B lymphocytes of active systemic lupus erythematosus (SLE) patients express lower level of CR1, the inhibitory capacity of this complement receptor is still maintained and its ligand-induced clustering results in significant inhibition of the main B cell functions, similar to that found in the case of healthy individuals. PMID: 27981054 CyaA binding did not trigger downstream signaling of CR3 in human monocytes and CyaA-catalyzed elevation of cAMP effectively blocked CR3 signaling initiated by a natural ligand. PMID: 26650353 the Putative Role of CR1 in Alzheimer's Disease PMID: 26914463 Knops blood group antigen a/b genotype was associated with increased susceptibility to severe malaria and the b/b genotype was associated with reduced risk of severe malaria. PMID: 25916414 The C4d/CR1 ratio is a simple and quickly determinable biomarker that enables the differentiation between infection and flare-up in febrile SLE patients at initial evaluation. PMID: 26273660 This meta-analysis further supports previous findings that CR1 rs6656401 polymorphism contributes to Alzheimer's Disease susceptibility. PMID: 24878768 Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells PMID: 25742728 These results provide a framework for understanding how loss of CR1 expression on podocytes may contribute to complement-mediated damage in the kidney. PMID: 26260209 findings provide evidence that the A carrier (AG/GG) and the A allele of the ECR1 A3650G polymorphism may be correlated to the pathogenesis of NRDS and, hence, might be involved in the susceptibility to NRDS. PMID: 25494101 THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES PMID: 26189291 CR1 gene rs2274567 G/A, rs4844600 G/A, and rs2296160 C/T polymorphisms may not be involved in susceptibility to malaria in Chinese population. PMID: 25683978 In addition to being a risk factor for Alzheimer's disease development, a CR1 SNP appears to be associated with higher rates of medium-term disease progression PMID: 24998857 Data indicate that complement activation promote complement component 3 C3b deposition on native and acetylated LDL and binding to the complement receptor 1 (CR1). PMID: 25349208 A meta-analysis demonstrated significant associations of both the CR1 rs6656401 and CR1 rs3818361 polymorphisms with late-onset Alzheimer's disease susceptibility. PMID: 24996192 CR1 SNPs correlates with specific aspects of cognitive impairment in Alzheimer's disease patients. PMID: 24530172 This study identified nominally significant or suggestive associations between the LOAD-risky CR1 variants and worse Logical Memory immediate recall scores in blacks. PMID: 23643458 Increased CR1 expression was associated with histology classification. PMID: 23464487 CR1 rs7525160 G > C polymorphism was associated with an increased risk of developing non-small cell lung cancer in Chinese population PMID: 24621201 Polymorphism of the complement receptor 1 gene correlates with the hematologic response to eculizumab in patients with paroxysmal nocturnal hemoglobinuria. PMID: 24038027 this is the first study to elucidate the relationship of the L-CR1 transcript with the disease activity of RA patients. PMID: 24433281 Using mutagenesis and structural biology to map the binding site for the Plasmodium falciparum merozoite protein PfRh4 on the human immune adherence receptor. PMID: 24214979 Maternal coding variants in complement receptor 1 is associated with spontaneous idiopathic preterm birth. PMID: 23591632 two Alzheimer's disease-associated CR1 variants, rs6656401 and rs3818361, are associated with major recurrent depression in females in a population-based cohort using individuals from the Generation Scotland: Scottish Family Health Study PMID: 22244847 It did not explain (part of) the association of genome wide association top single-nucleotide polymorphisms rs3818361/rs6656401, nor of the CR1copy number variation, with Alzheimer disease in our cohort PMID: 23582656 ATP release following CR1 ligation increases the mobility of the lipid fraction of RBC membranes, which in turn facilitates CR1 clustering, and thereby enhances the binding avidity of complement-opsonized particles to the RBC CR1. PMID: 24022490 Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection. PMID: 23376460 The CD35 antigen bounds gp350/220 and became latently infected when the fusion receptor HLA II was coexpressed. PMID: 23416052 Genome-wide association studies found 3 new susceptibility loci for Alzheimer disease(AD): complement receptor 1,clusterin,and the phosphatidylinositol-binding clathrin assembly protein. These SNPS are not associated with AD in a Polish population. PMID: 23650005 Our findings suggest complex mechanisms underlying the interaction of CR1, APOE, and brain amyloid pathways in Alzheimer disease PMID: 23022416 Complement receptor type 1 (CR1, CD35) is a potent inhibitor of B-cell functions in rheumatoid arthritis patients. PMID: 22962438 We identified rare small events overlapping CR1 and BIN1 in Alzheimer's disease and normal controls with opposite copy number variation dosage. PMID: 23202439 Malaria inhibits surface expression of complement receptor 1 in monocytes/macrophages, causing decreased immune complex internalization. PMID: 23440418 There are fewer mono- or dinucleated, but dramatically more numbers of tri- or polynucleated megakaryocytes in the bone marrow of transgenic Crry mice. PMID: 23390291 Common CR1 variants significantly protect against severe malaria in an endemic area. PMID: 23152904 In conclusion, despite there are some limitations, this meta-analysis indicates that the A allele of the CR1 SNP rs6656401 is significantly associated with LOAD susceptibility in Chinese Han populations. PMID: 22960360 The clustering phenomenon of CR1 in erythrocytes is identified in electron microscopy. PMID: 22374251 our results support that the CR1-S isoform explains the GWAS signals and open a novel prospect for the investigation of CR1-related disease mechanisms. PMID: 22819390 Simultaneous quantitative analysis of CD64 and CD35 expression on neutrophils might be useful to distinguish between bacterial and viral infections in rheumatoid arthritis patients. PMID: 22237765 CR1 (CD35) and CR3 (CD11b/CD18) act in concert for phagocytosis of opsonized Francisella tularensis by human neutrophils. PMID: 22888138 CLU and CR1 were associated with more rapid cognitive decline. PICALM was associated with an earlier age at midpoint of cognitive decline. PMID: 22952074

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.