Recombinant Human Complement Component C8 Gamma Chain (C8G) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06867P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Complement Component C8 Gamma Chain (C8G) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06867P
Save $813
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Complement Component C8 Gamma Chain (C8G) Protein (His) is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P07360
Target Symbol C8G
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag N-10His
Target Protein Sequence QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Expression Range 21-202aa
Protein Length Full Length of Mature Protein
Mol. Weight 23.9 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.
Subcellular Location Secreted.
Protein Families Calycin superfamily, Lipocalin family
Database References

HGNC: 1354

OMIM: 120930

KEGG: hsa:733

STRING: 9606.ENSP00000224181

UniGene: PMID: 12220191

  • structure of a C8gamma.laurate complex revealed Y83 and Y131 can move to allow penetration of hydrocarbon chain of laurate into the lower cavity. A Y83W mutation blocked access but had no effect on the ability of C8gamma to enhance C8 cytolytic activity PMID: 17452033

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed