Recombinant Human Complement C5 (C5) Protein (His-SUMO)

Name: Recombinant Human Complement C5 (C5) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09085P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Complement components, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Complement C5 (C5) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01031
Target Symbol	C5
Synonyms	Anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5; C5a anaphylatoxin; C5a; C5b; CO5_HUMAN; Complement C5 alpha'' chain; Complement C5; Complement component C5; CPAMD4; prepro-C5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Expression Range	678-751aa
Protein Length	Partial
Mol. Weight	24.3kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.; Derived from proteolytic degradation of complement C5, C5a anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Subcellular Location	Secreted.
Database References	HGNC: 1331 OMIM: 120900 KEGG: hsa:727 STRING: 9606.ENSP00000223642 UniGene: PMID: 29885865 recombinant C5a potentiated TNFalpha-induced NF-kappaB activation in renal tubular epithelial cells PMID: 29031143 tumoral C5a is an independent adverse prognostic biomarker for clinical outcome of Clear Cell Renal Cell Carcinoma patients after nephectomy. PMID: 27381421 C5a synergises with P. aeruginosa LPS in both PD-L1 expression and the production of IL-10 and TGF-beta. PMID: 27624143 these results not only confirm the critical role of C5b-9 in complement-mediated hemolysis and but also highlight the critical role of C5b-9 in inflammasome activation. PMID: 27444648 Mean cerebrospinal fluid C5 levels increased in patients with depression and schizophrenia. PMID: 29454970 elevated in the cerebrospinal fluid of preterm newborns PMID: 27806664 Up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. PMID: 29575196 This study provides the preclinical rationale for the combined blockade of PD-1/PD-L1 and C5a to restore antitumor immune responses, inhibit tumor cell growth, and improve outcomes of patients with lung cancer PMID: 28288993 Diagnosis and therapeutic management of neonatal hemochromatosis cannot only be based on C5b9 expression in liver samples as it is not specific of this disease. PMID: 28085791 C5a-C5aR enriched clear cell renal cell carcinoma patients significantly had a poorer overall survival and recurrence free survival after nephrectomy. PMID: 27821813 C5a/C5aR pathway promotes gastric cancer pathogenesis by suppressing p21/p-p21 expression via activation of PI3K/AKT signaling. PMID: 29031586 this study shows that C5 acts in the control of serum triglycerides and cholesterol, liver cholesterol deposition, liver homeostasis and C5 promotes a pro-inflammatory liver environment in our mouse model of alcoholic liver disease PMID: 26896155 a library of 61 peptides based on the C-terminus of C5a was assayed for the ability to selectively modulate C5aR2 function. PMID: 27108698 Data show the expression of a neoepitope which was exposed on complement C5 (C5) after binding to eculizumab in vivo. PMID: 28610663 Plasma levels of sC5b-9 were significantly increased in patients with thrombotic microangiopathy after allogeneic stem cell transplantation. PMID: 28801815 C5 gene analysis revealed two novel mutations as causative of C5 deficiency in 3 north African families PMID: 27026170 data indicate that properdin enhances platelet/granulocyte aggregates (PGAs) formation via increased production of C5a, and that inhibition of properdin function has therapeutic potential to limit thromboinflammation in diseases characterized by increased PGA formation PMID: 27183616 this study shows that complement C5a-induced changes in neutrophil morphology during inflammation PMID: 28671713 Increased C5a expression is associated with increased inflammation in cystic fibrosis. PMID: 28278205 Our results provide evidence that an intrinsic C5a generation may not be fully blocked by eculizumab in various disease settings. Controlling and fully blocking C5a induced signaling in humans therefore warrants a targeted approach PMID: 28366510 These findings, together with data from genomic variation databases, indicate a 0.5-2% prevalence of the Complement factor 5 (C5) p.A252T mutation in heterozygosity in sub-Saharan Africa. Therefore, this mutation may have a relevant role in meningococcal disease susceptibility in this geographical area. PMID: 28369827 we found the GG variant contributing to the risk of LAA-subtype ischemic stroke but were unable to find an association between ischemic stroke functional outcome at 90 days and C5 rs17611 variants. PMID: 27901252 this study shows that C5a signaling induces apoptosis in brain vascular endothelial cells in experimental lupus PMID: 27213693 We determined the genotypes of five polymorphisms (rs12237774, rs17611, rs4837805, rs7026551, and rs1017119) of C5 gene. In univariate analysis, rs17611 was significantly associated with Ischemic Stroke (IS) in the additive model, the dominant model, and recessive model. In this sample of patients, genetic variation of rs17611 in C5 is associated with higher prevalence of IS. PMID: 27768391 the complement anaphylatoxin C5a shows an inverse correlation with platelet bound oxLDL. The relationship of oxidized lipids to particular complement components may add to the platelet-lipid interplay in atherogenesis and trigger future clinical and mechanistic studies. PMID: 27025272 In an arterial thrombosis model, plasminogen activator administration increased C5a levels. Overall, these findings suggest plasmin bridges thrombosis and the immune response by liberating C5a and inducing MAC assembly. PMID: 27077125 C5 rs2269067 GG genotype confers risk for proliferative diabetic retinopathy of type 2 diabetes in Chinese Han population (associated with an elevated C5 mRNA expression and an increased IL-6 production) PMID: 26934706 C5a can induce the expression of TLR4 in retinal pigment epithelial cells. PMID: 26487798 elevated in the inflammatory lesions of placentas with villitis of unknown etiology PMID: 25725937 These results identify complement activation product C5a as a priming signal for RPE cells that allows for subsequent inflammasome activation by stimuli such as lipofuscin-mediated photooxidative damage. PMID: 26565031 a significant up-regulation (173 fold increase, p < 0.0001) in the expression of inflammatory complement component 5 (C5) in endometriosis was detected for the first time. PMID: 24316322 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis. PMID: 25735751 complement C5a signaling supports human stem cell pluripotency and survival, and thus may play a key role in shaping early human embryonic development PMID: 25132103 Rs2900180 in C5-TRAF1 and linked variants in a 66Kb region were associated with radiographic progression in ACPA-negative RA PMID: 25566937 The C5 rs2269067 GG genotype confers risk for AAU in a Chinese population and is associated with an elevated C5 serum concentration and an increased IL-17 production. PMID: 26230759 TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population. PMID: 25500258 This study shows that individuals homozygously expressing the rheumatoid arthritis risk s17611 allele exhibit increased C5a and decreased C5 in plasma, evidence of increased C5 turnover. PMID: 25725109 Elevated sC5b-9 levels are indicative of active disease in atypical hemolytic uremic syndrome. PMID: 25818678 In conclusion, the present study indicates that C5a may promote the proliferation of breast cancer cells through Akt1 activation of the RGC-32 gene. PMID: 25230890 C5A is released from C5 by a cancer cell membrane bound serine protease which enchances neoplasm invasiveness, immune evasion, and neovascularization. PMID: 25050844 The interaction between S1P and C5a plays an important role in neutrophils for antineutrophil cytoplasmic antibody -mediated activation PMID: 25000985 Our data provide new insights into the regulatory role of C5a in PMN function during systemic C. albicans infection in human blood and identify C5a as an essential mediator of PMN activation in response to C. albicans. PMID: 25539819 This report includes seven affected families indicating that C5 deficiency is not rare in South Africa. PMID: 25534848 This study reveals that the C5 complement protein may play a critical role in mediating white matter injury through inflammation in the setting of chronic cerebral hypoperfusion. PMID: 24386419 the role of C5a as an endogenous priming signal that is required for the initiation of uric acid crystal-induced IL-1beta production. PMID: 25229885 Spontaneous abortion is associated with elevated systemic C5a and reduced mRNA of complement inhibitory proteins in placenta. PMID: 24802103 C5a, but not C5a-des Arg, was able to induce further heteromer formation between complement C5a receptors. PMID: 24060963 Data indicate that cholesterol crystals (CC) employed C5a in the release of IL-1beta. PMID: 24554772 Serum level of initiating complement factor (C1q) but not complement regulator C5 is deficient in schizophrenic patients. PMID: 23235303

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.