Recombinant Human Complement C1Q Tumor Necrosis Factor-Related Protein 3 (C1QTNF3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05229P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Complement C1Q Tumor Necrosis Factor-Related Protein 3 (C1QTNF3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05229P
Regular price
$1,40400
$1,404.00
Sale price$24000
$240.00Save $1,164
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Complement C1Q Tumor Necrosis Factor-Related Protein 3 (C1QTNF3) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9BXJ4 |
Target Symbol | C1QTNF3 |
Synonyms | C1ATNF3; C1q and tumor necrosis factor related protein 3 ; C1QT3_HUMAN; C1qtnf3; Cartonectin; Collagenous repeat containing sequence of 26 kDa; collagenous repeat-containing sequence 26 kDa protein; Complement C1q tumor necrosis factor related protein 3 ; Complement C1q tumor necrosis factor-related protein 3; Corcs; CORS 26; Cors; CORS26; CTRP3; FLJ37576; OTTHUMP00000115918; OTTHUMP00000219981; PRO1484; Secretory protein CORS26; UNQ753 |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
Expression Range | 28.1 kDa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 28.1 kDa |
Research Area | Metabolism |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Subcellular Location | Secreted. |
Database References | |
Tissue Specificity | Expressed in colon and small intestine. |
Gene Functions References
- we have developed a diagnostic and prognostic prediction model for Prostate cancer. C1QTNF3 was revealed as a promising biomarker for Prostate cancer PMID: 29861410
- CTRP3 may be a promising therapeutic target for the treatment of liver fibrosis. PMID: 28320106
- Elevated serum CTRP 3 levels were closely related to the prevalence and severity of coronary artery disease, suggesting that it might be regarded as a novel biomarker for CAD. PMID: 28754090
- defensive roles in suppressing inflammation and fibrosis in polymeric IgA complex-stimulated mesangial cells; may target the NF-kappaB and TGF-beta/Src-Smad3 signaling pathways to play multipotent roles in relieving the pathological progression of IgA nephropathy PMID: 27309491
- CTRP3 promotes mitochondrial biogenesis in cardiomyocytes via AMPK/PGC-1alpha pathway. PMID: 27793739
- Low CTRP3 expression is associated with diabetic retinopathy. PMID: 28632765
- decreased levels of CTRP3 and especially CTRP13 were associated with increased risk of T2DM and CAD PMID: 28033351
- both plasma CTRP-3 and HMGB-1 levels were significantly associated with pre-diabetes mellitus and newly diagnosed type 2 diabetes after adjusting for several confounders PMID: 27738641
- This research suggested that CTRP3 might protect chondrocytes against IL-1beta-induced osteoarthritis in a cell model by suppressing the FGFR1- Ras/PI3K/Akt signaling-mediated growth inhibitory pathway. PMID: 27930985
- CTRP3 could improve insulin sensitivity of insulin resistant 3T3-L1 adipocytes by decreasing inflammation and ameliorating insulin signalling transduction, indicating that CTRP3 may be a new target for the prevention and cure of insulin resistance and type 2 diabetes. PMID: 25185846
- CTRP3 is present in cord blood and might be involved in fetal growth PMID: 26656444
- CTRP3 overexpression altered chemokine levels and attenuated systemic inflammation in the setting of obesity. PMID: 26997632
- Lower Circulating C1q/TNF-Related Protein-3 (CTRP3) Levels Are Associated with Obesity PMID: 26222183
- plasma CTRP-3 is strongly associated with glucose and lipid metabolism, chronic inflammation, and insulin resistance. PMID: 26073386
- Results show that cartonectin may serve as a novel biomarker for the prediction and early diagnosis of type 2 diabetes mellitus patients. PMID: 25409499
- Patients with acute coronary syndrome or stable angina pectoris had significantly lower circulating CTRP-3 concentrations compared to controls. PMID: 24417980
- CTRP3 promotes vascular calcification by enhancing phosphate-induced osteogenic transition of VSMC through reactive oxygen species-extracellular signal-regulated kinase 1/2-Runx2 pathway. PMID: 24578384
- Data suggest that serum/omental adipose tissue (AT) cartonectin levels are lower in women with polycystic ovary syndrome; treatment with a hypoglycemic agent (metformin) increases serum cartonectin levels in these women and in omental AT explants. PMID: 24152681
- Data suggest that CTRP3 is expressed in subcutaneous and visceral adipocytes; CTRP3 appears to play important roles in adipocyte (epinephrine-induced) lipolysis, inflammation/infection, and adipokine/resistin secretion. PMID: 23174996
- Data suggest that patients exhibit significantly elevated circulating CTRP-3 in type 2 diabetes or prediabetes compared with subjects with normal glucose tolerance. Plasma CTRP-3 might be useful biomarker for atherosclerosis. PMID: 22837306
- This study provides the first functional evidence linking CTRP3 to hepatic glucose metabolism and establishes CTRP3 as a novel adipokine. PMID: 20952387
- CTRP-3 inhibits three basic and common proinflammatory pathways involved in obesity and type 2 diabetes mellitus (adipo-inflammation) by acting as an endogenous LPS antagonist of the adipose tissue. PMID: 20739398
- Genotyping of the shared variants in a Puerto Rican sample of 118 cases and 136 controls did not reveal either allelic or genotype association with schizophrenia. PMID: 20483475
- Blood level is determined by a glucose tolerance test in normal adults PMID: 17311679
- CTRP3/cartducin may be involved as a novel angiogenic factor in the formation of neointima following angioplasty. PMID: 17534697
- CORS26/cartonectin is a new adipokine that differentially regulates the secretion of classical adipokines, with marked differences between the human and the murine systems. PMID: 18421280