Recombinant Human Complement C1Q Subcomponent Subunit A (C1QA) Protein (His-SUMO)

Name: Recombinant Human Complement C1Q Subcomponent Subunit A (C1QA) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04461P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Complement C1Q Subcomponent Subunit A (C1QA) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P02745
Target Symbol	C1QA
Synonyms	C1qa; C1QA_HUMAN; Complement C1q subcomponent subunit A; Complement component 1 q subcomponent A chain; Complement component 1 q subcomponent alpha polypeptide; Complement component C1q A chain
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Expression Range	23-245aa
Protein Length	Full Length of Mature Protein
Mol. Weight	39.7kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Subcellular Location	Secreted.
Database References	HGNC: 1241 OMIM: 120550 KEGG: hsa:712 STRING: 9606.ENSP00000363773 UniGene: PMID: 28325905 this study shows that regulatory dendritic cells can mediate a potent direct anti-inflammatory activity via the expression and/or secretion of molecules such as C1q, independently of their capacity to expand the pool of regulatory T cells PMID: 27731323 analysis of molecular signaling and inflammatory responses during ingestion of atherogenic lipoproteins modulated by complement protein C1q PMID: 27573737 these data show that C1q is involved in the process of embryo implantation contributing to the remodeling of spiral arteries PMID: 27687635 Studies indicate that complement C1q (C1q) is a multifunctional homeostatic regulator in the central nervous system (CNS). PMID: 28601358 We, for the first time, identified the associations between C1q gene SNPs and autoimmune thyroid diseases, and our findings suggested that five common SNPs in C1q gene were not associated with autoimmune thyroid diseases susceptibility in Chinese Han population PMID: 28225862 exposure of neural stem cells to neutrophil-synthesized concentrations of C1q and C3a promoted astrogliogenesis and cell migration PMID: 28687659 Anti-C1q-induced C1q secretion might be an important immune-modulatory factor in systemic lupus erythematosus. PMID: 27630215 this studies show binding of VWF to C1q and thus a direct interaction between starter molecules of hemostasis and the classical pathway of complement PMID: 27698012 Cerebrospinal fluid (CSF) soluble complement receptor 2 (sCR2) levels correlated significantly both with CSF complements C3 and C1q as well as to a disease severity measure. PMID: 27085202 decreased levels result in predominant skin manifestations in children PMID: 26563161 anti-C1q induced a proinflammatory phenotype in human monocyte-derived macrophages reversing the effects of immobilized C1q alone PMID: 26829984 These findings support a role for locally synthesized C1q in promoting tumor growth. PMID: 26831747 This study reveled that C1QA having a central role in the bipolar disease and schizophrenia manifestation. PMID: 25487697 The A allele and AA genotype of C1q rs292001 can be considered a susceptibility risk factor and the GG genotype could be considered protective for juvenile systemic lupus erythematosus and lupus nephritis in the studied cohort of Egyptian children. PMID: 26095468 no significant association found to either rs15940 (C1QA) or rs172378 (C1QC) when analysed in just Parkinson disease cases , just controls or combined PMID: 25817358 Elevation in serum C1q levels are associated with sarcopenia. PMID: 25491308 Our findings showed that Brugia malayi Calreticulin (BmCRT) is responsible for the prevention of classical complement pathway activation via its interaction with the first component C1q of the human host PMID: 25184227 interaction with calreticulin controls the phagocyte inflammatory status PMID: 24557008 C1q expression correlates with active disease in human tuberculosis. PMID: 24647646 A newly characterized leech calreticulin (HmCalR) has been shown to interact with C1q and participate to the HmC1q-dependent microglia accumulation. PMID: 24747831 PepO facilitates C1q-mediated bacterial adherence, whereas its localized release consumes complement as a result of its activation following binding of C1q, thus representing an additional mechanism of human complement escape by this versatile pathogen. PMID: 24739385 mutations are associated with development of lupus PMID: 24331529 Data indicate that complement C1q (C1q) deposition in kidney was comparable between patients with and without serum anti-C1q antibodies. PMID: 24053688 C1q was found to induce permeability of the endothelial cell monolayer, to stimulate EC proliferation and migration, and to promote tube formation and sprouting of new vessels in a rat aortic ring assay. PMID: 24591625 Both CERT isoforms, when immobilized, were found to bind the globular head region of C1q and to initiate the classical complement pathway. C1q binds endogenous CERTL on the surface of apoptotic cells. PMID: 24395916 Most likely, C1q bridges calreticulin on the parasite surface with its receptor orthologue on human placental cells, thus facilitating the first encounter between the parasite and the fetal derived placental tissue. PMID: 23991234 Data indicate that Cna binds to C1q. PMID: 23720782 Analysis of its interaction properties by surface plasmon resonance shows that rC1q retains the ability of serum C1q to associate with the C1s-C1r-C1r-C1s tetramer, to recognize physiological C1q ligands such as IgG and pentraxin 3 PMID: 23650384 Single nucleotide polymorphisms in and around the C1q genes, C1qA, C1qB and C1qC, correlated with C1q serum levels and may be a risk for the development of rheumatoid arthritis. PMID: 23607884 The ability of C1q to sense both human and bacterial GAPDHs sheds new insights on the role of this important defense collagen molecule in modulating the immune response. PMID: 23086952 identification of a new mutation in C1qA that disrupts the start codon (ATG to AGG (Met1Arg)) expands the knowledge and importance of the C1q gene in the pathogenesis of lupus, especially in the high-risk African-American population PMID: 22472776 We identified a major linear epitope of C1q that is the target of anti-C1q in systemic lupus erythematosis. PMID: 22740328 Annexin A2 and A5 serve as new ligands for C1q on apoptotic cells PMID: 22879587 The C1qA SNPs, rs172378 and rs665691, confer no genetic predisposition to systemic lupus erythematosus in a Chinese Han population PMID: 22236909 This study demonstrated that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surfac. PMID: 22356764 C1qA can counteract the function of the C1q receptor gC1qR in RIG-I-mediated signalling PMID: 22260551 A genetic association of the TRAF1/C5, C1q, and eNOS gene polymorphism, but not of STAT4 and PTPN22, was found to confer a degree of risk for systemic lupus erythematosus in the Turkish population. PMID: 21968398 analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages PMID: 21862594 There was no association between C1QA rs292001 genetic variants and schizophrenia when compared to healthy subjects. PMID: 21951915 Results suggest a novel mechanism for pathogen entry into host cells as well as a new function for C1q- alpha2beta1 integrin interactions. PMID: 21134100 Data show that the C1q binding assay could discriminate between different levels of aggregates where ACA had reached a plateau. PMID: 21256764 C1q may induce tolerogenic properties in developing dendritic cells. PMID: 21429584 we present evidence suggesting that microglia are capable of phagocytosing and clearing cellular debris of degenerating neurons from the substantia nigra pars compacta through a C1q-mediated pathway PMID: 21343881 The presence of anti-globular head fragment in both healthy and diseased humans also implies that these antibodies, unlike anti-collagen-like region, may have a contribution to an onset of autoimmunity. PMID: 21159384 reduced levels of the expression of C1q by dendritic cells and macrophages in the esophagus may play a role in the formation of immune responses associated with the formation of specialized intestinal metaplasia and the development of adenocarcinoma. PMID: 20496011 In a large family-based association study of C1Q gene cluster polymorphisms no evidence for a genetic role of C1Q locus SNP in systemic lupus erythematosus risk predisposition was obtained in patients of European ancestry. PMID: 20528885 Analysis of human C1q by combined bottom-up and top-down mass spectrometry. PMID: 20008834 A 29-month-old boy presented with facial rash and history of early death of a sibling with infections, was found to have a selective deficiency of C1q with a homozygous point mutation in the C1qA gene cahin. PMID: 20560256 Data show that C1q, C4, C3, and C9 bind to thrombin receptor-activating peptide-activated platelets in lepirudin-anticoagulated platelet-rich plasma (PRP) and whole blood. PMID: 20139276

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.