Recombinant Human Collectin-11 (COLEC11) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03720P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.
Recombinant Human Collectin-11 (COLEC11) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03720P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Collectin-11 (COLEC11) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9BWP8 |
| Target Symbol | COLEC11 |
| Synonyms | CL K1; CL K1 I; CL K1 II; CL K1 IIa; CL K1 IIb; CL-K1; CLK1; COL11_HUMAN; COLEC 11; COLEC11; Collectin 11; Collectin kidney I; Collectin kidney protein 1; Collectin sub family member 11; Collectin-11; Collectin11; DKFZp686N1868; MGC129470; MGC129471; MGC3279 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM |
| Expression Range | 26-271aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 30.1kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis. |
| Subcellular Location | Secreted. |
| Protein Families | COLEC10/COLEC11 family |
| Database References | HGNC: 17213 OMIM: 265050 KEGG: hsa:78989 STRING: 9606.ENSP00000339168 UniGene: PMID: 28772263 |
