Recombinant Human Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01368P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01368P
Regular price
$1,32200
$1,322.00
Sale price$29900
$299.00Save $1,023
/
Product Overview
Description | Recombinant Human Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q96CG8 |
Target Symbol | CTHRC1 |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
Expression Range | 31-243aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 27 kDa |
Research Area | Cell Migration |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May act as a negative regulator of collagen matrix deposition. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Database References | |
Associated Diseases | Barrett esophagus (BE) |
Tissue Specificity | Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells. |
Gene Functions References
- CTHRC1 serves as a pro-metastatic gene that contributes to NSCLC invasion and metastasis, which are mediated by upregulated MMP7 and MMP9 expression. Targeting CTHRC1 may be beneficial for inhibiting NSCLC metastasis. PMID: 29631554
- High Collagen Triple Helix Repeat Containing 1 Expression is associated with Osteosarcoma. PMID: 29970438
- E6/E7-p53-POU2F1-CTHRC1 axis promotes cervical cancer cell invasion and metastasis PMID: 28303973
- IL-1beta and CTHRC1 are upregulated in patients with Osteoarthritis. PMID: 29393342
- CTHRC1 interacts with integrin beta3 and accelerates the FAK phosphorylation to promote ovarian cancer cell adhesion, migration and invasion in vitro and in vivo. PMID: 29021002
- CTHRC1 plays a pivotal role in a great many fields, including increases bone mass, prevents myelination, reverses collagen synthesis in keloid fibroblasts, and increases fibroblast-like synoviocytes migration speed and abundant production of arthritic pannus in rheumatoid arthritis PMID: 28901303
- CTHRC1, negatively regulated by miR-30c, promoted cell proliferation, invasion and migration and suppressed cell apoptosis in breast cancer, which might be by activating GSK-3beta/beta-catenin signaling and inhibiting Bax/Caspase-9/Caspase-3 signaling respectively. PMID: 28697793
- Our data suggest that CTHRC1 may act as an oncogenic driver in progression and metastasis of ESCC, and may serve as a potential biomarker for prognosis and personalized therapy. PMID: 28645305
- The negative and sensitivity-predictive values of CTHRC1 staining were excellent for both lymph node and peritoneal metastases. PMID: 27870703
- High CTHRC1 expression is associated with metastatic melanomas. PMID: 26918341
- CTHRC1 was established as a novel marker of activated synoviocytes in murine experimental arthritis and rheumatoid arthritis PMID: 27430622
- ANOS1 and its co-expression partner, CTHRC1, promote the development and metastasis of colorectal cancer. PMID: 28854193
- Expression of CTHRC1 was significantly higher in Wilms' tumor compared to the expression in the adjacent non-cancerous tissues. High tumor expression of CTHRC1 was associated with tumor size, clinical stage, histopathological type, and vascular invasion/metastasis. Patients with high CTHRC1 expression also exhibited a shorter survival. PMID: 27230801
- CTHRC1 expression is significantly upregulated in human masticatory mucosa during wound healing. PMID: 28005267
- CTHRC1 downregulation inhibited proliferation. PMID: 28281968
- The knockdown of CTHRC1 exerts inhibitory effects on the proliferation and migration ability of glioblastoma cells. PMID: 28277194
- CTHRC1 may play a role in the progression of ovarian cancer. PMID: 27779718
- this study shows that the serum CTHRC1 level was significantly higher in the influenza A virus infection patients than in the healthy individuals; the influenza A virus non-structural protein NS1 upregulates the expression of CTHRC1 protein PMID: 27718266
- Gene expression levels of three randomly selected DEGs, VCAN, COL5A1 and KCNJ16, were examined using RT-PCR in 10 ATC samples.. angiogenesis was activated by the high expression of CTHRC1, VCAN and POSTN, providing necessary nutrition for tumor cells PMID: 27599582
- increased CTHRC1 expression is associated with advanced TNM stage, increased LN metastasis and tumor size, and decreased OS and DFS, indicating that CTHRC1 may be a biomarker for prognosis of cancer patients PMID: 27323076
- High CTHRC1 expression is associated with Osteosarcoma. PMID: 27043295
- Authors showed that ectopic transfection of CTHRC1 in EOC cells up-regulated the expression of EMT markers such as N-cadherin and vimentin, and EMT-associated transcriptional factor Snail. PMID: 26452130
- CTHRC1 is secreted both by colorectal epithelia cells and stromal fibroblasts. CTHRC1 overexpression promotes colorectal cancer cell migration, invasion and proliferation in vitro. PMID: 26722469
- determined the mRNA and protein expression of CTHRC1 in oral squamous cell carcinoma and evaluated the clinical and prognostic impact of CTHRC1 overexpression PMID: 26664254
- CTHRC1 has a novel role in viral infection. PMID: 26180054
- HBV facilitates HCC development through activating the oncoprotein CTHRC1. PMID: 25263696
- CTHRC1 was overexpressed in human non-small cell lung cancer tissues and non-small cell lung cancer cell lines at the protein and mRNA level. PMID: 25238260
- let-7b may directly target Cthrc1 and function as a tumor suppressor gene in gastric cancer. PMID: 25510669
- CTHRC1 acts as a prognostic factor and promotes invasiveness of gastrointestinal stromal tumors by activating Wnt/PCP-Rho signaling. PMID: 24726140
- Cthrc1 overexpression was associated with non-small cell lung cancers. PMID: 25139095
- Cthrc1 is a pituitary hormone with significantly elevated levels in subjects carrying variant alleles of the melanocortin-1 receptor as wells as in patients with inflammatory conditions. PMID: 24945147
- CTHRC1 has the potential to be a new biomarker for the aggressive hepatocellular carcinoma PMID: 24841500
- CTHRC1 expression is elevated in human colon cancer cell lines and clinical specimens, and promotes cancer cell invasivity through ERK-dependent induction of MMP9 expression. PMID: 24504172
- Studied CTHRC1 expression in human breast cancer tissue. A significant increase of CTHRC1 mRNA expression was seen in breast cancer tissue compared to the normal tissue from the same patients using RT-PCR and real-time PCR. PMID: 23658133
- Overexpression of CTHRC1 in hepatocellular carcinoma promotes tumor invasion and predicts poor prognosis. PMID: 23922981
- Rs35500845 in the CTHRC1 gene was associated with Paget's disease of bone in the French-Canadian population. PMID: 24370779
- high Cthrc1 expression was an independent prognostic factor for both overall survival and disease-free survival of patients with gastric carcinoma PMID: 24746208
- Data suggest that in oral squamous cell carcinoma (OSCC), dysregulation of canonical Wnt signaling and DPAGT1-dependent N-glycosylation induces CTHRC1, thereby driving OSCC cell migration and tumor spread. PMID: 23703614
- this is the first demonstration of Cthrc1 as a marker of the severity of the disease progression in the dystrophic muscles. PMID: 23274062
- the results of our study suggest that increased expression of CTHRC1 is associated with peritoneal carcinomatosis in Colorectal cancer patients PMID: 23359115
- CTHRC1 has a role in pancreatic cancer progression and metastasis by regulating migration and adhesion activities of cancer cells. PMID: 23222813
- Data indicate that the upregulated expression of collagen triple helix repeat containing 1 (CTHRC1) in gastric carcinogenesis contributes to tumor cell invasion and metastasis. PMID: 22590977
- Three major genes, MSR1, ASCC1, and CTHRC1 were associated with Barrett esophagus/esophageal adenocarcinoma PMID: 21791690
- CTHRC1 is transiently expressed in the arterial wall in response to injury where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration. PMID: 15618538
- Aberrant expression of CTHRC1 is widely present in human solid cancers and seems to be associated with cancer tissue invasion and metastasis. PMID: 16778098
- Intracellular localization of Cthrc1 characterizes differentiated smooth muscle. PMID: 18467647