Recombinant Human Collagen alpha-3 (COL6A3) Protein (His/Tag-Free)
Beta LifeScience
SKU/CAT #: BLC-05291P
Recombinant Human Collagen alpha-3 (COL6A3) Protein (His/Tag-Free)
Beta LifeScience
SKU/CAT #: BLC-05291P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Collagen alpha-3 (COL6A3) Protein (His/Tag-Free) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P12111 |
| Target Symbol | COL6A3 |
| Synonyms | CO6A3_HUMAN; COL6A3; Collagen alpha-3(VI) chain; Collagen type VI alpha 3; Collagen VI alpha 3 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-His/Tag-Free |
| Target Protein Sequence | KPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG |
| Expression Range | 2986-3176aa |
| Protein Length | Partial |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Collagen VI acts as a cell-binding protein. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix. |
| Protein Families | Type VI collagen family |
| Database References | HGNC: 2213 OMIM: 120250 KEGG: hsa:1293 STRING: 9606.ENSP00000295550 UniGene: PMID: 30066698 |
