Recombinant Human Collagen alpha-3 (COL4A3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04498P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Collagen alpha-3 (COL4A3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04498P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Collagen alpha-3 (COL4A3) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q01955 |
| Target Symbol | COL4A3 |
| Synonyms | Alpha 3 type IV collagen; Alpha3 type IV collagen; CO4A3_HUMAN; COL4A 3; Col4a3; Collagen alpha 3(IV) chain; Collagen IV alpha 3 polypeptide; Collagen type IV alpha 3 (Goodpasture antigen); Collagen type IV alpha 3; Collagen type IV alpha 3 chain; Goodpasture antigen; OTTHUMP00000195044; Tumstatin |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK |
| Expression Range | 1427-1668aa |
| Protein Length | Partial |
| Mol. Weight | 30.6 kDa |
| Research Area | Cell Adhesion |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.; Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity; these two anti-tumor properties may be regulated via RGD-independent ITGB3-mediated mechanisms. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix, basement membrane. |
| Protein Families | Type IV collagen family |
| Database References | HGNC: 2204 OMIM: 104200 KEGG: hsa:1285 STRING: 9606.ENSP00000379823 UniGene: PMID: 28152559 |
