Recombinant Human Collagen alpha-1 (COL18A1) Protein (His)

Name: Recombinant Human Collagen alpha-1 (COL18A1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03342P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Collagen alpha-1 (COL18A1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P39060
Target Symbol	COL18A1
Synonyms	Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Expression Range	1578-1754aa
Protein Length	Partial
Mol. Weight	21.3kDa
Research Area	Cell Adhesion
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.; May regulate extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells; the function requires homotrimerization and implicates MAPK signaling.; Potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. Inhibits VEGFA-induced endothelial cell proliferation and migration. Seems to inhibit VEGFA-mediated signaling by blocking the interaction of VEGFA to its receptor KDR/VEGFR2. Modulates endothelial cell migration in an integrin-dependent manner implicating integrin ITGA5:ITGB1 and to a lesser extent ITGAV:ITGB3 and ITGAV:ITGB5. May negatively regulate the activity of homotrimeric non-collagenous domain 1.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, extracellular matrix, basement membrane.; [Non-collagenous domain 1]: Secreted, extracellular space, extracellular matrix, basement membrane. Secreted.; [Endostatin]: Secreted. Secreted, extracellular space, extracellular matrix, basement membrane.
Protein Families	Multiplexin collagen family
Database References	HGNC: 2195 OMIM: 120328 KEGG: hsa:80781 STRING: 9606.ENSP00000347665 UniGene: PMID: 29781737 Increased serum levels of endostatin were associated with loss of graft function in kidney transplant recipients. PMID: 29528011 endostatin may have a role in subclinical atherosclerosis as shown in a study of a healthy Japanese population PMID: 28428451 a protease capable of producing endostatin from human Col XVIII, is reported PMID: 27921229 Structural and biological functions of COL18A1, such as its requirement in the maintenance of basement membrane integrity and its emerging roles in regulating cell survival, stem or progenitor cell maintenance and differentiation and inflammation have been reported. (Review) PMID: 27746220 Lower endostatin levels or a predominance of VEGF over endostatin are predictors of poor short-term prognosis of intracranial atherosclerotic stenosis. PMID: 28189572 We further show that the SAGA deubiquitinase-activated gene Multiplexin (Mp) is required in glia for proper photoreceptor axon targeting. Mutations in the human ortholog of Mp, COL18A1, have been identified in a family with a SCA7-like progressive visual disorder, suggesting that defects in the expression of this gene in SCA7 patients could play a role in the retinal degeneration that is unique to this ataxia. PMID: 27261002 Two COL18A1 variants co-segregated with familial epilepsy and anterior polymicrogyria in a family. PMID: 28602933 Blood endostatin wasdddddddddddddddddddddddddf significantly higher in chronic hepatitis C patients with liver fibrosis compared to those without fibrosis. PMID: 27930387 The homozygous DN and NN genotypes of COL18A1 D104N were associated with the risk of osteosarcoma. PMID: 26617886 Endostatin is increased in patients with primary sjogren's syndrome patients with interstitial lung disease. PMID: 27214260 Data show that endostatin levels were elevated in patients with systemic sclerosis (SSc) and mixed connective tissue disease (MCTD). PMID: 26315510 promoter methylation significantly increased in nasal polyp tissues PMID: 26275402 Collaterals formation seems to be associated with the activation of pro-inflammatory factors, growth factors and endostatin in chronic heart failure. PMID: 26771970 Genebased analyses revealed associations of the COL18A1 gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis. PMID: 25424718 Study demonstrates that endostatin has novel ATPase activity, which mediates its antiangiogenic and antitumor activities. PMID: 25788476 ADAM8 and endostatin play a role in osteosarcoma progression. PMID: 25481287 High endostatin expression is associated with malignant pleural effusions in lung cancer. PMID: 25339042 In 2 large cohort studies using serum endostatin as a marker for disease severity and mortality in pulmonary arterial hypertension, a variant in the gene encoding ES, Col18a1, was linked independently with reduced mortality. PMID: 25489667 Serum endostatin is raised in older men who have symptoms of intermittent claudication. PMID: 24600079 The ratio of VEGF/endostatin levels was significantly higher in operable non-small cell lung cancer patients than in normal controls. PMID: 24998915 Female type 2 diabetes mellitus patients have higher serum endostatin levels than males and exercise increases levels in both sexes. PMID: 24393402 Our preliminary findings provide new evidence that endostatin/collagen XVIII concentration in the CSF increases substantially in patients with sTBI PMID: 24089677 Higher endostatin levels are associated with increased risk of early onset pre-eclampsia PMID: 23958573 Hepatocellular carcinoma shows significantly elevated serum levels of angiogenic factors VEGF and Ang-2 and of anti-angiogenic factors endostatin and angiostatin. PMID: 23912396 These results suggest genetic variation in COL15A1 and COL18A1 can modify the age of onset of both early and late onset POAG. PMID: 23621901 data suggest that KS is only caused by biallelic mutations in COL18A1 PMID: 23667181 indicative of good tumor blood supply and permeability of vasculature, are associated with high levels of collagen XVIII and VEGF expression PMID: 23605255 High serum endostatin was associated with increased mortality risk in 2 independent community-based cohorts of the elderly. PMID: 24030549 Transcription levels of VEGF and endostatin by RT-PCR may be an adjunct to cytology screening for early detection of cervical carcinomas and may determine the progressive potentiality of individual lesions, especially in high-risk patients. PMID: 24021340 Binding of VEGF-C and endostatin to recombinant VEGFR-3 is competitive. PMID: 22512651 common germline variants in Endostatin and eNOS genes have predictive significance for clinical outcome and survivality in advanced gastric cancer patients treated with first-line chemotherapy. PMID: 23641912 Report pre/postoperative endostatin levels in surgically treated gastrointestinal cancers. PMID: 22819906 a potential role for collagen XXIII in mediating metastasis by facilitating cell-cell and cell-matrix adhesion as well as anchorage-independent cell growth. PMID: 21963851 Endostatin lowers blood pressure via nitric oxide and prevents hypertension associated with VEGF inhibition PMID: 22733742 In osteosarcoma, expression of endostatin was positively correlated with that of CD34, and was greater in poorly differentiated osteosarcoma than in highly differentiated osteosarcoma. Expression of endostatin correlated with osteosarcoma metastasis. PMID: 22009965 The detection of VEGF mRNA and endostatin mRNA appears to be suitable for distinguishing carcinoma cells from reactive mesothelial cells in pleural effusions, they could be useful to diagnose the pleural micrometastasis. PMID: 22431315 Findings indicate that COL18A1 rs7499 may contribute to the risk of Hepatocellular carcinoma (HCC) in Han Chinese. PMID: 22461898 Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors. PMID: 22303445 study demonstrated significantly elevated endostatin levels in serum and urine samples of bladder cancer patients and show that high endostatin serum concentrations significantly correlate with the presence of lymph node metastasis PMID: 21815140 Peripheral blood osteopontin (OPN) and endostatin (END) levels were studied in 35 patients with adrenal cortex tumors and 10 patients with pheochromocytoma before unilateral adrenalectomy, as well as in 10 healthy subjects (controls). PMID: 21968021 Endostatin induces autophagy in endothelial cells by modulating Beclin 1 and beta-catenin levels PMID: 19298526 Cysteine cathepsins S and L modulate anti-angiogenic activities of human endostatin. PMID: 21896479 Endostatin can effectively inhibit rat peritoneum neoangiogenesis and the effect was dose-dependent. PMID: 21457400 The aim of the study was to evaluate and compare the circulating concentrations of OPN, E-selectin and END of severely obese patients with metabolic syndrome before and after vertical banded gastroplasty. PMID: 21486700 Common polymorphisms in four candidate genes (COL11A1, COL18A1, FBN1 and PLOD1) were unlikely to play important roles in the genetic susceptibility to high myopia. PMID: 21527992 Lack of collagen XVIII long isoforms affects kidney podocytes, whereas the short form is needed in the proximal tubular basement membrane PMID: 21193414 Data show that hypertriglyceridemia occurs in Knobloch patients lacking the vascular form of Col18. PMID: 21085708 suggest that collagen XVIII/endostatin preserves the integrity of the extracellular matrix and capillaries in the kidney, protecting against progressive glomerulonephritis PMID: 20616167 Elevated preoperative serum levels of endostatin in patients with clear cell renal cell carcinoma are associated with higher stage and grade. PMID: 19615205

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.