Recombinant Human Collagen alpha-1 (COL17A1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-04961P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Collagen alpha-1 (COL17A1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-04961P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Collagen alpha-1 (COL17A1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9UMD9
Target Symbol COL17A1
Synonyms COL17A1; BP180; BPAG2Collagen alpha-1(XVII) chain; 180 kDa bullous pemphigoid antigen 2; Bullous pemphigoid antigen 2) [Cleaved into: 120 kDa linear IgA disease antigen; 120 kDa linear IgA dermatosis antigen; Linear IgA disease antigen 1; LAD-1); 97 kDa linear IgA disease antigen; 97 kDa linear IgA bullous dermatosis antigen; 97 kDa LAD antigen; 97-LAD; Linear IgA bullous disease antigen of 97 kDa; LABD97)]
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
Expression Range 1253-1497aa
Protein Length Partial
Mol. Weight 28.4kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.; The 120 kDa linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies.
Subcellular Location Cell junction, hemidesmosome. Membrane; Single-pass type II membrane protein. Note=Localized along the plasma membrane of the hemidesmosome.; [120 kDa linear IgA disease antigen]: Secreted, extracellular space, extracellular matrix, basement membrane. Note=Exclusively localized to anchoring filaments. Localized to the epidermal side of split skin.; [97 kDa linear IgA disease antigen]: Secreted, extracellular space, extracellular matrix, basement membrane. Note=Localized in the lamina lucida beneath the hemidesmosomes.
Database References

HGNC: 2194

OMIM: 113811

KEGG: hsa:1308

STRING: 9606.ENSP00000340937

UniGene: PMID: 27306323

  • Bullous pemphigoid patients with the HLA-DQB1*03:01 allele show an increased T-cell avidity to several epitopes of BP180, particularly the BP180-NC16a domain. (Review) PMID: 28101965
  • C-terminal processing induces dynamic structural changes and neoepitopes for linear IgA dermatosis autoantibodies on COL17 PMID: 28842325
  • As a consequence of altered maturation and decreased stability of collagen XVII trimers, reduced collagen XVII is incorporated into the cell membrane, resulting in compromised dermal-epidermal adhesion. Taken together, using this genetic model, we provide the first proof that alteration of the coiled-coil structure destabilizes oligomerization and impairs physiological shedding of collagen XVII in vivo. PMID: 28365758
  • Pathogenicity of autoantibodies targeting COL17 is epitope dependent. PMID: 26827765
  • The corneal dystrophy mapped to chromosome 10q23-q24 is associated with the c.3156C>T variant in COL17A1. PMID: 27309958
  • Data suggest that type XVII collagen (COL17) internalization/macropinocytosis by keratinocytes induced by IgG autoantibodies from patients with bullous pemphigoid (BP) is mediated by PKC (protein kinase C) calcium signaling pathway; BP IgG induced overabundant phosphorylation of COL17. PMID: 27775687
  • we have produced five new versatile monoclonal antibodies against the Col 17 endodomain that are superior to ectodomain antibodies in diagnosing and differentiating between JEB-gen intermed and JEB-loc/carriers PMID: 26334130
  • Results show that aberrant epigenetic control is a key driver of COL17A1 gene misexpression and tumor cell invasion in a variety of epithelial neoplasm. These findings have significant clinical implications, suggesting that the COL17A1 promoter methylation status can be used to predict patient outcome. PMID: 27891193
  • Case Report: IgA autoantibodies targeting the NC16A domain rather than the shed ectodomains of COL17 resulted in linear IgA bullous dermatosis in a pregnant woman. PMID: 27786348
  • ELISA for IgE anti-NC16a is a helpful parameter in the modification of current treatment and the assessment of risk of relapse in bullous pemphigoid. PMID: 25791894
  • R1303Q in COL17 hampers C-terminal cleavage of COL17. Increase in remnants of non-cleaved COL17 ectodomain in extracellular matrix (ECM) induces aberrant laminin 332 deposition in ECM, which may be associated with disorganized basement membrane formation. PMID: 26604146
  • The COL17A1 c.3156C-->T variant is the likely causative mutation in our recurrent corneal erosion families, and its presence in 4 independent families suggests that it is prevalent in epithelial recurrent erosion dystrophy. PMID: 26786512
  • Elevated serum levels of BP180 antibodies in the first trimester of pregnancy precede gestational pemphigoid and remain elevated for a long time after remission of the disease. PMID: 25758329
  • Letter/Case Report: IgE BP180 antibodies contribute to the occurrence of urticarial erythema in bullous pemphigoid patients. PMID: 25771164
  • IgE anti-BP180 autoantibody level is increased in some Chinese patients with bullous pemphigoid. PMID: 25797173
  • The aging process can be recapitulated by Col17a1 deficiency and prevented by the forced maintenance of COL17A1 in hair follicle stem cell (HFSCs), demonstrating that COL17A1 in HFSCs orchestrates the stem cell-centric aging program of the epithelial mini-organ. PMID: 26912707
  • Our findings implicate presumed gain-of-function COL17A1 mutations causing dominantly inherited ERED and improve understanding of the underlying pathology. PMID: 25676728
  • Case Reports: two Japanese patients with bullous pemphigoid with only BP230 autoantibodies detected by ELISA. PMID: 24676568
  • Circulating anti-BP180 autoantibodies are not correlated with severity of genital lichen sclerosis or itching. PMID: 24676719
  • study reports for the first time the expression of collagen XVII in colon epithelium and the association of increased collagen XVII immunoexpression with poor outcome in colorectal carcinoma. PMID: 25623077
  • Variants of the PTCH1 and COL17A1 genes may contribute to the development of Ossification of the posterior longitudinal ligament. PMID: 24668667
  • Lack of C17 led to decreased melanin intensity and melanocyte density in the epidermis when compared with the revertant patches. In human skin, melanocyte supply to the epidermis depends on C17 expression in keratinocytes. PMID: 24330315
  • Missense mutation R1303Q in COL17a1 causes junctional epidermolysis bullosa phenotype similar to Kindler syndrome. PMID: 24005051
  • Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (r = 0.557, P value < 0.0001) and ABSIS (r = 0.570, P value < 0.0001) values. PMID: 23227089
  • The results of this study suggest that BP180 internalization induced by bullous pemphigoid IgG plays an important role in the initiation of disease pathogenesis. PMID: 23337823
  • found the full-length collagen XVII protein in proliferating tissue melanocytes, basal keratinocytes and squamous cell carcinoma whereas resting melanocytes were negative PMID: 22688676
  • Collagen XVII (BP180) modulates keratinocyte expression of the proinflammatory chemokine, IL-8. PMID: 22775995
  • Collagen XVII has a function in the attachment of podocyte foot processes to the glomerular basement membrane. PMID: 22457199
  • migrating keratinocytes shed the Ecto-ColXVII, and this dynamically binds via its C-terminal domain to distinct partners in the ECM PMID: 21801871
  • presence of minor amounts of collagen XVII protein in JEB skin is associated with mild phenotypic manifestations. PMID: 21357940
  • Cell surface COL17 can interact with laminin 332 and, together, participate in the adherence of a cell to the extracellular matrix. PMID: 21034821
  • Alterations in type I hemidesmosome components (BP180 and BP230) are suggestive of epigenetic control in the salivary glands of patients with Sjogren's syndrome. PMID: 21305504
  • small proportion of pregnant women produce protein-specific IgE autoantibodies PMID: 20471095
  • anti-hBPAG2 IgG was initially directed against extracelllar domain epitopes;humoral responses subsequently targeted additional extra and intracellular domain BPAG2 epitopes PMID: 19812601
  • Depletion of CD4-positive T cells as well as CD45R-positive B cells in an immunodeficient transgenic mouse model of bullous pemphigoid inhibits production of anti-human COL17 IgG antibodies in the recipients, resulting in no apparent clinical phenotype. PMID: 20089696
  • The role of collagen XVII in both autoimmune and genetic blistering disorders demonstrates its relevance to dermal-epidermal adhesion PMID: 19945617
  • We describe a Chinese family with generalized atrophic benign epidermolysis bullosa (GABEB). serine to cysteine at position 265. novel polymorphic substitution of C-to-G at nucleotide position 798 in exon 10 of the COL17A1 gene, an I233M change in BPAG2 PMID: 11912005
  • this protein, an epithelial adhesion protein, is shed from the cell surface by ADAMs PMID: 12356719
  • Mutations in the coding sequence of the human collagen XVII (COL17A1) gene are not the cause of Thiel-Behnke Corneal Dystrophy. PMID: 14562173
  • truncation of the intracellular domain of BP180 impairs the organization of hemidesmosomes, affecting both the mechanical stability of basal keratinocytes and dermoepidermal cohesion. PMID: 14962091
  • bullous pemphigoid sera reacted with at least an additional antigenic site other than the NC16A, within the extracellular (37%) and intracellular (28%) domains of BP180. PMID: 14962097
  • genetic variation in COL17A1 shows no association with susceptibility to bullous pemphigoid. PMID: 14987253
  • Dimished, but correctly localised expression of BP180 in epidermolysis bullosa; COL15 mutated BP180 is still partly functional. PMID: 15009107
  • the conformation of the NC16A domain and steric availability of the cleavage site influence shedding and is important for folding of collagen XVII PMID: 15047704
  • C-terminus of collagen XVII binds to laminin 5, revealing the role of collagen XVII in the regulation of keratinocyte migration. PMID: 15161638
  • Data show that the expression of laminin gamma2 chain and collagen type XVII is altered in endometrial adenocarcinomas. PMID: 15609083
  • expression of BP180 is related to clinical severity of bullous pemphigoid PMID: 15734283
  • Epitooe mapping of anti-BP180 immunoglobulin E autoantibodies in bullous pemphigoid. PMID: 16117787
  • Deletions in recombinant proteins affect thermal stability. PMID: 16354180
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed