Recombinant Human Collagen alpha-1 (COL13A1) Protein (His&My/His/Tag-Free)
Beta LifeScience
SKU/CAT #: BLC-11289P
Recombinant Human Collagen alpha-1 (COL13A1) Protein (His&My/His/Tag-Free)
Beta LifeScience
SKU/CAT #: BLC-11289P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Collagen alpha-1 (COL13A1) Protein (His&My/His/Tag-Free) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q5TAT6 |
| Target Symbol | COL13A1 |
| Synonyms | CODA1_HUMAN; COL13A1; collagen type XIII alpha 1; collagen alpha 1(XIII) chain ; Collagen alpha-1(XIII) chain; COLXIIIA1 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-His&C-Myc/N-His/Tag-Free |
| Target Protein Sequence | KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGIPGQKGEIGLPGPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGEKGETGQAGSPGEKGEAGEKGNPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEKGFQGEKGDRGPLGLPGASGLDGRPGPPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK |
| Expression Range | 432-717aa |
| Protein Length | Partial |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in cell-matrix and cell-cell adhesion interactions that are required for normal development. May participate in the linkage between muscle fiber and basement membrane. May play a role in endochondral ossification of bone and branching morphogenesis of lung. Binds heparin. At neuromuscular junctions, may play a role in acetylcholine receptor clustering. |
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. Cell junction, synapse, postsynaptic cell membrane. |
| Database References | HGNC: 2190 OMIM: 120350 KEGG: hsa:1305 STRING: 9606.ENSP00000381949 UniGene: PMID: 29307798 |
