Recombinant Human Coagulation Factor Xiii B Chain (F13B) Protein (His-GST&Myc)

Name: Recombinant Human Coagulation Factor Xiii B Chain (F13B) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-01029P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Coagulation Factor Xiii B Chain (F13B) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P05160
Target Symbol	F13B
Synonyms	(Fibrin-stabilizing factor B subunit)(Protein-glutamine gamma-glutamyltransferase B chain)(Transglutaminase B chain)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	WYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVM
Expression Range	260-403aa
Protein Length	Partial
Mol. Weight	51.5 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin.
Subcellular Location	Secreted.
Database References	HGNC: 3534 OMIM: 134580 KEGG: hsa:2165 STRING: 9606.ENSP00000356382 UniGene: PMID: 28865246 The results suggest that plasma FXIII levels are subjected to multifactorial regulation with age, fibrinogen level and FXIII-B intron K polymorphism being the major determinants. Their effect on FXIII levels might influence the risk of thrombotic diseases. PMID: 27821352 Genetic markers associated with low FXIIIB levels increase risk of ischemic stroke cardioembolic subtype. PMID: 26159793 The FXIII-B intron K nt29756 G allele was associated with significant protection against CAS and MI in patients with a fibrinogen level in the upper tertile. PMID: 25569091 Changes in plasma levels of FXIIIB are associated with cognitive decline in the elderly. PMID: 26088309 Here, we update the knowledge about the pathophysiology of factor XIII deficiency and its therapeutic options. [review] PMID: 24503678 Case Report: congenital FXIII-B deficiency in which alloantibodies developed to exogenous FXIII-B. PMID: 23407795 FXIIIb subunit is found to be within normal range in eight Tunisian famillies with congenital factor XIII deficiency caused by two mutations, while expression of the FXIIIA subunit gene is decreased or undetectable. PMID: 19937244 Develop ELISA/chemoluminescence assay demonstrating that FXIII-A and FXIII-B are low concentration components of tear proteome. PMID: 20079358 role of FXIIIB in modifying catalytic activity of FXIIIA2 during factor XIII mediated crosslinking of fibrinogen PMID: 11816711 F13 B subunit antigen may have a role in susceptibility to stroke based on this study of family members of patients in South Asia PMID: 15634282 Genetic variants of factor XIIIb were evaluated on the effects of survival in myocardial infarction. PMID: 17515963 at least 3 out of the 10 Sushi domains of FXIII-B have the distinct function of forming a homodimer and a heterotetramer, which should be ascribed to the differences in their amino acid sequences PMID: 18652485 A specific colorimetric assay for measuring FXIIIB activity is reported. PMID: 19646949

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.