Recombinant Human Coagulation Factor Xi (F11) Protein (His)

Beta LifeScience SKU/CAT #: BLC-02829P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Coagulation Factor Xi (F11) Protein (His)

Beta LifeScience SKU/CAT #: BLC-02829P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Coagulation Factor Xi (F11) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P03951
Target Symbol F11
Synonyms coagulation factor XI; Coagulation factor XIa light chain; F11; FA11_HUMAN; FXI; MGC141891; Plasma thromboplastin antecedent; Platelet coagulation factor XI ; PTA
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR
Expression Range 19-387aa
Protein Length Partial
Mol. Weight 45.2kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Subcellular Location Secreted.
Protein Families Peptidase S1 family, Plasma kallikrein subfamily
Database References

HGNC: 3529

OMIM: 264900

KEGG: hsa:2160

STRING: 9606.ENSP00000384957

UniGene: PMID: 27723456

  • The aim of the current study was to analyze, for the first time in the Portuguese population, five well known and replicated venous thromboembolism - associated single nucleotide polymorphisms in genes ABO (rs2519093 and rs8176719), F11 (rs2036914 and rs2289252) and FGG (rs2066865), and to determine its possible association with risk for venous thromboembolism. PMID: 29995659
  • Data indicate four new factor XI (FXI) gene defects potentially causing a functional deficiency and the duplication of 1653 bp involving exons 8 and 9. PMID: 28960694
  • In this prospective cohort of elderly adults, there was no statistically significant association of higher FXI levels with incident coronary heart disease and stroke. PMID: 28009647
  • High molecular weight kininogen has an inhibitory effect on nucleic acid-supported fXI activation and may function as a negative regulator of fXI activation. PMID: 28124063
  • FXI has a role in promoting a vascular coagulation-inflammatory circuit in arterial hypertension PMID: 28148841
  • thrombin activatable fibrinolysis inhibitor pathway impairment, largely caused by a hitherto unknown TAFIa resistance, appears to be one main cause of decreased fibrinolytic resistance in FXI deficiency PMID: 27094709
  • factor XI has a role in procoagulant microparticle-promoted coagulation in human endotoxemia PMID: 26857798
  • Three loci showed robust, replicating association with circulating FXI levels: KNG1 (rs710446, P-value = 2.07 x 10-302), F11 (rs4253417, P-value = 2.86 x 10-193), and a novel association in GCKR (rs780094, P-value = 3.56 x10-09), here for the first time implicated in FXI regulation. The two first SNPs (rs710446 and rs4253417) also associated with partial thromboplastin time PMID: 28053049
  • The rs710446 and five low-frequency variant sets in KNG1 with FXI level variation of Factor XI were significant after multiple testing correction and permutation. PMID: 28445521
  • Exploring the global landscape of genetic variation in coagulation factor XI deficiency PMID: 28615222
  • Structures of FXI in complex with the laminin-derived peptide EFPDFP and a DFP peptide from the random screen demonstrated binding in the same pocket, although in a slightly different conformation, thus revealing some flexibility in the molecular interactions of the FXI apple 2 domain. PMID: 27006387
  • inhibition of FXI and FXII distinctly alter the biophysical properties of fibrin. PMID: 27933406
  • Data show that among the studied polymorphisms, only coagulation factor XI (F11) single nucleotide polymorphism rs2289252 was significantly associated with venous thrombosis (VT) and the F11 rs2289252-A allele was associated with a 1.6-fold increased risk of VT PMID: 27414984
  • Thus in conclusion, the bleeding manifestations in FXI deficiency are varied and unpredictable; neither correlates with FXI levels nor with the mutations. Comprehensive analysis of all the factors including both plasma and platelet FXI, global hemostatic factors like thrombin generation potential may indicate a potential laboratory indicator for FXI deficiency related bleeding manifestations. PMID: 27710856
  • Fasudil reduced LPS-mediated TF and PAI-1 expression and activity in PBMCs. These effects may partially be relevant to the clinical benefits of fasudil in the treatment of CAPD patients. PMID: 27756191
  • rs2289252 and rs2036914 polymorphisms have important role in development of venous thromboembolism in the white race PMID: 28353616
  • High activity of factor XI indicates a risk of occurrence of deep vein thrombosis in post-trauma patients with fractures. F11 rs2089252 and rs2036914 (single nucleotide polymorphisms) are associated with activity of factors XI in such patients despite prophylaxis. PMID: 27627722
  • this study confirms the significant associations between polymorphism of 25264C.T in FXI and its activity and the risk of deep vein thrombosis after artificial joint replacement surgery PMID: 26934731
  • F11 genetic variants are associated with the risk of incident venous thrombosis among women PMID: 26631918
  • This study characterized FXI deficiency mutation spectrum in Chinese population with a high frequency of the W228*, G400V, Q263* and c.1136-4delGTTG mutations, which is distinct from that of other populations including Korean, Jewish or European populations. PMID: 27067486
  • factor XI is localized to GPIb in membrane rafts and that this association is important for promoting the activation of factor XI by thrombin on the platelet surface PMID: 12517745
  • higher basal factor XI concentration in the general population is not a risk marker for stroke or coronary heart disease PMID: 26386215
  • Factor XI and factor XII activities were significantly higher in patients with slow coronary flow than in controls, and could be associated with enhanced procoagulant state present in these patients. PMID: 24509324
  • FXI-thrombin axis contributes to distal platelet activation and procoagulant microaggregate formation in the blood flow downstream of the site of thrombus formation. PMID: 26769048
  • F11 gene variant rs2289252 contributes to inherited forms of deep vein thrombosis incidence in Latvian population. PMID: 25091233
  • These studies enhance understanding on the first allosteric inhibitor of FXIa and highlight its value as a promising anticoagulant. PMID: 25935648
  • ROTEM assays failed to distinguish bleeding from non-bleeding patients but could do so between different FXI activity levels and genotypes. PMID: 26160656
  • increased activity of FXI may be a potential risk factor for miscarriage; high activity of FXI diagnosed in women with history of miscarriage is not probably caused by the presence of SNPs rs2289252 and rs2036914 PMID: 25517908
  • Data indicate that the mean factor XI (FXI) was not significantly different in laboratories using the same method on both exercises, suggesting good intralaboratory precision over time. PMID: 25976967
  • Identification of a novel c.290G>A mutation in the F11 gene that is associated with mild Factor XI deficiency in a Dutch Caucasian family. PMID: 25618263
  • In whites, the FXI variant was associated with both factor XI concentration and venous thromboembolism (VTE) incidence (1.15-fold greater incidence of VTE per risk allele), whereas In African-Americans, these associations were absent. PMID: 26260105
  • Mass spectrometry analyses of FXI revealed full occupation of two of the three heavy-chain glycosites and almost full-site occupancy of the light chain. Analysis of FXI glycopeptides by LC-MS/MS enabled site-specific glycan profiling and occupancy. PMID: 25092234
  • This study presents the first application of a new thrombin generation based factor XIa assay. PMID: 25288467
  • study determined the molecular basis of FXI deficiency in 6 unrelated severely deficient patients in China; reported 8 mutations in FXI gene leading to FXI deficiency; functional consequences of a novel mutation leading to FXI deficiency have been elucidated PMID: 25681615
  • FXI expression is directly regulated by a specific miRNA, miR-181a-5p, in the human liver PMID: 25379760
  • FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either PMID: 24977287
  • We suggested that the minor allele of rs3756008 in the promoter of FXI gene could reduce its expression in kidney. PMID: 24420855
  • at variance with other populations, no single major founder effect is present in Italian patients with FXI deficiency. PMID: 24112640
  • Genetic variants of coagulation factor XI show association with ischemic stroke up to 70 years of age. PMID: 24086496
  • Identification of a novel candidate F11 gene mutation associated with a cross-reacting material positive plasma FXI deficiency. PMID: 23571684
  • Studies indicate that in the past two decades, more than 220 mutations in the factor XI (FXI) gene have been reported in patients with FXI deficiency, of which 7 showed a founder effect. PMID: 23929304
  • a novel mutations in family with inherited factor XI deficiency PMID: 23494098
  • Propose that long polyphosphates promote FXII-mediated blood coagulation bypassing FXI. PMID: 23659638
  • The rather rare type I mutation in the FXI gene is a third founder mutation in Ashkenazi Jews with factor XI deficiency. PMID: 23332144
  • For activation by thrombin, or during autoactivation, the data support a cis-activation mechanism in which the activating protease binds to and activates the same fXI subunit. PMID: 23515926
  • F11 gene mutational screening revealed 11 different DNA variations, 3 of which had not yet been described PMID: 23305485
  • Factor XI is a substrate for oxidoreductases: enhanced activation of reduced FXI is found in antiphospholipid syndrome thrombosis. PMID: 22704541
  • A novel amino acid substitution in the serine protease catalytic domain (Ile463Ser) appears to be responsible for the congenital factor XI deficiency in a Swiss family. PMID: 22322133
  • The F11 rs2289252 polymorphism is associated with FXI activity levels and APTT ratio in women with thrombosis. PMID: 22633531
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed