Recombinant Human Coagulation Factor V (F5) Protein (His-SUMO)

Name: Recombinant Human Coagulation Factor V (F5) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04038P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Coagulation Factor V (F5) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P12259
Target Symbol	F5
Synonyms	Activated protein C cofactor; APC cofactor; coagulation factor V (proaccelerin; labile factor); Coagulation factor V; coagulation factor V jinjiang A2 domain; Coagulation factor V light chain; F5; FA5_HUMAN; Factor V Leiden; FactorV; FVL; Labile factor; PCCF; Proaccelerin; proaccelerin; labile factor; Protein C cofactor; RPRGL1; THPH2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Expression Range	1490-1614aa
Protein Length	Partial
Mol. Weight	30.4kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Subcellular Location	Secreted.
Protein Families	Multicopper oxidase family
Database References	HGNC: 3542 OMIM: 188055 KEGG: hsa:2153 STRING: 9606.ENSP00000356771 UniGene: PMID: 29703881 study found the FVL A allele frequency and GA genotype are significantly more prevalent among patients with coronary artery disease (CAD) compared to controls and may be predisposing to CAD; further found that the FVL mutation is an independent risk factor whose effect is not modified by other risk factors; FV HR2 variation does not show any statistically significant association with CAD PMID: 29179580 suggesting that the FVL paradox is related to the carriership of one wild type and one mutated factor V allele PMID: 29320959 Review/Meta-analysis: Factor V G1691A single nucleotide gene polymorphism was associated with risk of ischemic stroke mainly in young adults. PMID: 29478939 Factor V Leiden mutation is associated with venous thromboembolism in cancer. PMID: 29775482 Human FVL carriers have a higher total sperm count than non-carriers, with an adjusted mean difference of 31 x 106 (95%CI 0.2-61.7; P = 0.048). PMID: 28927238 contribution of FVLeiden causing resistance to activated protein C in Indian population is not as strong as previously reported in Western countries PMID: 26699866 The frequencies of GA and AA genotypes and A allele of coagulation factor V (FV) 1691G>A polymorphism significantly increased in the lower extremity deep venous thrombosis (LDVT) group. Patients with LDVT carrying A allele (GA + AA) had both higher patency and recurrence rates than those carrying GG genotype. Coagulation factor V (FV) 1691G>A polymorphism may be associated with both the risk and prognosis of LDVT. PMID: 29851809 Factor V Leiden-mutations were found in 16.8% of patients with cerebral sinus venous thrombosis and in 17.8% of patients with arterial ischemic stroke, which was significantly more frequent than in controls at a rate of 4.95% (ORs: 3.89 and 4.16). PMID: 28869458 Double heterozygotes had a clinical presentation intermediate between FVL and prothrombin mutation single carriers. PMID: 28577389 genetic study of Factor V Leiden (G1691A) mutation in young ischemic strokes with large vessel disease in a South Indian population PMID: 28711293 results suggest that some SNPs of F5 and a high or low FV:C level might be associated with recurrent miscarriage PMID: 27655299 FVBonn induces hypercoagulability via a combination of increased activation/procoagulant activity, decreased susceptibility to Activated protein C-mediated inactivation, and slightly reduced APC cofactor activity PMID: 27090446 Heterozygous FV Leiden, homozygous PAI-1 4G/4G, heterozygous MTHFR C677T, homozygous MTHFR A1298C, as much as the combined thrombophilic genotypes MTHFR 677T + ACE Iota/D, MTHFR 677T/1298C + ACE D/D, ACE I/D + b-fibrinogen -455 G/A, FV HR2 + b-fibrinogen -455 G/A showed a correlation as risk factors for Recurrent pregnancy loss. PMID: 28603947 the signaling and anticoagulant functions of APC are in spatially and kinetically distinct compartments, and that it is possible to specifically inhibit the anticoagulant activity of APC. Targeting APC with a serpin is remarkably effective and may be safe for long-term prophylactic use in the treatment of hemophilia. PMID: 28632502 Cleavage of FV at Arg(1545) , which abolishes the anticoagulant properties of FV and commits FV to the procoagulant pathway, is inhibited by binding of the TFPIalpha C-terminus to the FV acidic region PMID: 27801970 The goal of this study was to evaluate the impact of EHR point-of-care tools on medical record documentation of genetic testing care processes for the common HFE mutations, a thrombophilia panel, and HLA-B27. PMID: 27362912 Aside from a higher venous thromboembolism (VTE) prevalence and modestly reduced VTE-free survival, VTE penetrance and phenotype severity did not differ significantly among homozygous vs. heterozygous carriers. PMID: 26970916 there is a synergistic effect of the FVL and rs4524 single nucleotide polymorphisms and active cancer on the risk of VTE. PMID: 27479824 Our finding that the C2-domain of FVIII can be replaced by that of FV without compromising FVIII activity may have translational implications. PMID: 28057741 These results demonstrate a new anticoagulant (cofactor) function of FV that targets the early phase of coagulation before prothrombinase assembly PMID: 28420729 There was an increased odds of stillbirth for maternal homozygous factor V Leiden mutation. PMID: 27131585 The Leiden mutation was significantly associated with recurrent pregnancy loss (p=0.017) PMID: 26564286 The present meta-analysis suggests that V Leiden G1691A mutation is not significantly associated with increased risk of sudden sensorineural hearing loss in Italian population. PMID: 26620341 Factor V Leiden was not associated with recurrent miscarriage during the first trimester of pregnancy in Brazilian women. PMID: 27525841 Gene polymorphisms F5 C>G (rs6427196) were not associated with height, weight, or morbid obesity among European subjects. PMID: 27999448 The carriage of mutant genotypes of FV 1691 G/A gene is a prognostic factor for rapid liver fibrosis progression in patients with Chronic hepatitis C. PMID: 27636933 Our data demonstrated a significantly increased risk of hemodialysis vascular access thrombosis in carriers of the mutant FV (G1691A and A4070G) polymorphisms (P< 0.05) PMID: 27004938 Desmopressin acetate has no effect on FV plasma concentration in patients with combined deficiency of factors V and VIII. PMID: 26599105 F5 rs6025 and F11 rs2289252 contributed to the risk of recurrent venous thromboembolism and the combination is of potential clinical relevance for risk prediction PMID: 26423325 Factor V (F5) c.1691G>A (Leiden) was present in 0.5% of 400 ischemic stroke patients in Sri Lanka. F5 mutation was present in a statistically significant number of patients with venous thrombosis (P = .005) compared to those with arterial thrombosis. PMID: 26522268 FVL has a modifying effect on PAI-1 polymorphism in relation to risk of VTE recurrence. PMID: 26245493 combination of FVL and MTHFR mutation related to the risk of recurrent fetal death and habitual abortion PMID: 25586317 Case Report: acquired FV inhibitor that developed in a patient after exposure to human thrombin used as a hemostatic agent during an otorhinolaryngology surgical procedure. PMID: 26270511 In the current study Factor V Leiden, prothrombin G20210A, and thrombospondin-1 polymorphisms showed no association with severity of hepatic fibrosis. PMID: 26768578 Chromosomal abnormalities and abnormalities in the genes related to thrombophilia such as FVL, MTHFR and PTm mutations may be considered as risk factors for RM [recurrent miscarriage] PMID: 26060483 Given the essential role of platelet-derived factor Va in clot formation, understanding the cellular and molecular mechanisms that regulate how platelets acquire this molecule will be important for the treatment of excessive bleeding or clotting PMID: 25800007 F5 polymorphisms are not significant in the susceptibility to femoral head osteonecrosis in the Korean population. PMID: 26130054 ). No significant difference was observed in the presence of FV 1691G/A and FII 20210G/A between any of the patients groups and the control group. PMID: 26261166 the diagnosis of an 'unaffected' foetus was offered. The child was subsequently followed up after delivery and was found to be normal for factor V levels with a normal genotype PMID: 26261171 Data (including data from case-control, genetic association studies) suggest that Factor V mutation Leiden is associated with significant genetic predisposition for venous thromboembolism (not thrombophilia) in pregnancy. [META-ANALYSIS, REVIEW] PMID: 26115054 C2491T FV mutation associated with ischaemic stroke risk in Morocco, is reported. PMID: 26174681 genetic association studies in population in Czech Republic: Data suggest point mutation in FV (Leiden) is associated with outcome in patients with hereditary thrombophilia/diabetes/limb ischemia following percutaneous transluminal angioplasty. PMID: 26247037 FVL mutation is a significant determinant of coronary artery disease risk. PMID: 24360889 Activated protein C has anti-inflammatory effects on human dendritic cells. PMID: 25891444 Polymorphisms in factor V and antithrombin III gene in recurrent pregnancy loss PMID: 25771983 presence of three novel variants in F5 gene in Chilean patients with activated protein C resistance; further studies are required to investigate the real contribution of these novel mutations to the APC resistance phenotype PMID: 25668227 FV Leiden is a genetically determined and thus disease-independent parameter, which is associated with venous thromboembolism in cancer patients and could therefore be used for individual risk assignment. PMID: 25381723 In mice, heterozygous FV Leiden carriers are protected from sepsis mortality after infection with clinically relevant human bacterial pathogens. PMID: 25690763 Our study does not support the notion that factor V HR2 haplotype might be a risk factor for thrombosis despite its high prevalence among patients with PE. PMID: 26717220

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.