Recombinant Human Coactosin-Like Protein (COTL1) Protein (His-SUMO)

Name: Recombinant Human Coactosin-Like Protein (COTL1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09966P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Coactosin-Like Protein (COTL1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q14019
Target Symbol	COTL1
Synonyms	CLP; Coactosin like 1; Coactosin-like protein; COTL1; COTL1_HUMAN; FLJ43657; MGC19733
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Expression Range	2-142aa
Protein Length	Full Length of Mature Protein
Mol. Weight	31.8kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
Subcellular Location	Cytoplasm. Cytoplasm, cytoskeleton. Nucleus.
Protein Families	Actin-binding proteins ADF family, Coactosin subfamily
Database References	HGNC: 18304 OMIM: 606748 KEGG: hsa:23406 STRING: 9606.ENSP00000262428 UniGene: Hs.289092
Tissue Specificity	Widely expressed with highest levels in placenta, lung, kidney and peripheral blood leukocytes and lower levels in brain, liver and pancreas.

Gene Functions References

Study uncovers a novel tumor-suppressor role for CLP/Cotl1 and identify the downstream effectors interleukin 24 (IL-24)/PERP and IL-24/MAPK/ERK/TGF-beta. PMID: 28925397
our combined results elucidated genetic and epigenetic silencing of miR-506-3p enhances COTL1 oncogene expression to foster NSCLC progression. PMID: 27893417
The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied. PMID: 25034252
COTL1 regulates lamellipodia dynamics in part by protecting F-actin from cofilin-mediated disassembly. PMID: 24454796
PAI-RBP1 and C1orf142 expression levels are higher in 95D (high metastatic potential) than in 95C (low metastatic potential) non-small lung cancer cells, whereas COTL1 expression level is lower in 95D when compared to 95C cells. PMID: 22373659
Up-regulated COTL-1 expression in small cell lung cancer was validated by Western blot analysis, immunohistochemistry, and qRT-qPCR. PMID: 21047053
Results of the present study support a role for CLP as a chaperoning scaffold factor, influencing both the stability and the activity of 5-LO. PMID: 19807693
CLP 57-65 peptide elicits immediate-type hypersensitivity. Identical peptides are recognized by cellular and humoral immune systems to a tumor-associated antigen. CLP 15-24 and 104-113 might be used for peptide-based immunotherapy of HLA-A2(+) cancers. PMID: 11870627
NMR resonance assignments and the secondary structures of human Coactosin like protein (hCLP) D123N PMID: 15213466
coactosin-like protein (CLP) is an actin-binding protein as well as a 5-lipoxygenase binding partner PMID: 15333945
structural analysis shows that CLP forms a polymer along the crystallographic b axis with the exact same repeat distance as F-actin; a model for the CLP polymer and F-actin binding has therefore been proposed. PMID: 15459340
preliminary crystallographic studies of human coactosin-like protein (CLP) PMID: 15583396
Coactosin-like protein (CLP) up-regulates Ca(2+)-induced 5-lipoxygenase (5LO) activity, and increases the amount of Leukotriene A(4) formed by 5LO. PMID: 16924104
extended region of beta4-beta5 of hCLP (residue 66-75) was found very flexible and very important for F-actin binding. The C-terminal residues of human coactosin-like protein were not involved in F-actin binding PMID: 17070122
We found that coactosin-like1 (COTL1) were highly expressed in rheumatoid arthritis patients compared with healthy controls PMID: 19307756

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.