Recombinant Human Cmrf35-Like Molecule 7 (CD300LB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10734P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cmrf35-Like Molecule 7 (CD300LB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10734P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Cmrf35-Like Molecule 7 (CD300LB) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | A8K4G0 |
Target Symbol | CD300LB |
Synonyms | CD300LB; CD300B; CLM7; CMRF35A2; IREM3; LMIR5; TREM5; UNQ2530/PRO6029CMRF35-like molecule 7; CLM-7; CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5; CD antigen CD300b |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY |
Expression Range | 18-151aa |
Protein Length | Extracellular domain |
Mol. Weight | 17.2kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | CD300 family |
Database References | |
Tissue Specificity | Expressed exclusively in myeloid lineages. |
Gene Functions References
- this paper identified CD300b as an lipopolysaccharide-recognizing receptor that regulated TLR4 signaling PMID: 27261276
- CD300LB expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
- CD300 molecules are all expressed by DC; CD300b, d, e and f are restricted to different subpopulations of the myeloid DC lineage. They have been shown to regulate DC function both in vitro and in vivo. PMID: 23072861
- CD300b defines a nonclassical Ig receptor able to trigger signals by coupling distinct mediators and thus initiating different signaling pathways PMID: 16920917
- although both mouse and human LMIR5 play activatory roles in innate immunity cells, the functions of LMIR5 were differentially regulated in mouse versus human cells. PMID: 17928527